eF-site ID 5zhx-h PDB Code 5zhx Chain h click to enlarge Title Crystal structure of SmgGDS-558 and farnesylated RhoA complex Classification ONCOPROTEIN Compound Rap1 GTPase-GDP dissociation stimulator 1 Source (RHOA_HUMAN) Sequence h:  AIRKKLVIVGDGACGKTCLLIVFSKENYVADIEVDGKQVE LALWDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ACL Description (1)  Rap1 GTPase-GDP dissociation stimulator 1 Functional site 1) chain h residue 191 type sequence L description binding site for Di-peptide FAR h 201 and CYS h 190 source : AC4 2) chain h residue 190 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI11 3) chain h residue 12 type BINDING sequence G description BINDING => ECO:0000269|PubMed:10748207, ECO:0000269|PubMed:12777804 source Swiss-Prot : SWS_FT_FI1 4) chain h residue 117 type BINDING sequence N description BINDING => ECO:0000269|PubMed:10748207, ECO:0000269|PubMed:12777804 source Swiss-Prot : SWS_FT_FI1 5) chain h residue 160 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P62820 source Swiss-Prot : SWS_FT_FI2 6) chain h residue 41 type MOD_RES sequence N description (Microbial infection) ADP-ribosylasparagine; by botulinum toxin => ECO:0000305|PubMed:1328215 source Swiss-Prot : SWS_FT_FI6 7) chain h residue 190 type MOD_RES sequence C description Cysteine methyl ester => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI9 8) chain h residue 135 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23871831 source Swiss-Prot : SWS_FT_FI14

Display surface Download Links