eF-site ID 5zhx-g PDB Code 5zhx Chain g click to enlarge Title Crystal structure of SmgGDS-558 and farnesylated RhoA complex Classification ONCOPROTEIN Compound Rap1 GTPase-GDP dissociation stimulator 1 Source (RHOA_HUMAN) Sequence g:  AIRKKLVIVGENYVADIEVDGKQVELALWDYDRLRPLSYP DTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILV GNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFG YMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL Description (1)  Rap1 GTPase-GDP dissociation stimulator 1 Functional site 1) chain g residue 189 type sequence G description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 2) chain g residue 191 type sequence L description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 3) chain g residue 185 type LIPID sequence K description (Microbial infection) N6-stearoyl lysine => ECO:0000269|PubMed:30061757 source Swiss-Prot : SWS_FT_FI10 4) chain g residue 186 type LIPID sequence K description (Microbial infection) N6-stearoyl lysine => ECO:0000269|PubMed:30061757 source Swiss-Prot : SWS_FT_FI10 5) chain g residue 187 type LIPID sequence K description (Microbial infection) N6-stearoyl lysine => ECO:0000269|PubMed:30061757 source Swiss-Prot : SWS_FT_FI10 6) chain g residue 190 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI11 7) chain g residue 12 type BINDING sequence G description BINDING => ECO:0000269|PubMed:10748207, ECO:0000269|PubMed:12777804 source Swiss-Prot : SWS_FT_FI1 8) chain g residue 117 type BINDING sequence N description BINDING => ECO:0000269|PubMed:10748207, ECO:0000269|PubMed:12777804 source Swiss-Prot : SWS_FT_FI1 9) chain g residue 160 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P62820 source Swiss-Prot : SWS_FT_FI2 10) chain g residue 189 type SITE sequence G description (Microbial infection) Cleavage; by yopT => ECO:0000269|PubMed:12062101, ECO:0000269|PubMed:12538863 source Swiss-Prot : SWS_FT_FI3 11) chain g residue 41 type MOD_RES sequence N description (Microbial infection) ADP-ribosylasparagine; by botulinum toxin => ECO:0000305|PubMed:1328215 source Swiss-Prot : SWS_FT_FI6 12) chain g residue 188 type MOD_RES sequence S description Phosphoserine; by PKG/PRKG1 => ECO:0000269|PubMed:11162591 source Swiss-Prot : SWS_FT_FI8 13) chain g residue 190 type MOD_RES sequence C description Cysteine methyl ester => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI9 14) chain g residue 135 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23871831 source Swiss-Prot : SWS_FT_FI14

Display surface Download Links