eF-site ID 5zhx-C PDB Code 5zhx Chain C click to enlarge Title Crystal structure of SmgGDS-558 and farnesylated RhoA complex Classification ONCOPROTEIN Compound Rap1 GTPase-GDP dissociation stimulator 1 Source (RHOA_HUMAN) Sequence C:  DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQ LINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLAELESS KEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAEND AIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDL MVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLA GALAIANFARNDANCIHMVDNGIVEKLMDLLDRHVEDGNV TVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEM PPVQFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCE AKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHL VTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLV QILHRLLADERSAPEIKYNSMVLICALMGSECLHKEVQDL AFLDVVSKLRSHENKSVAQQASLTEQRLT Description (1)  Rap1 GTPase-GDP dissociation stimulator 1 Functional site 1) chain C residue 124 type sequence Q description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 2) chain C residue 136 type sequence L description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 3) chain C residue 139 type sequence L description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 4) chain C residue 149 type sequence L description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 5) chain C residue 152 type sequence M description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 6) chain C residue 153 type sequence C description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 7) chain C residue 155 type sequence V description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3 8) chain C residue 159 type sequence N description binding site for Di-peptide FAR g 201 and CYS g 190 source : AC3

Display surface Download Links