eF-site ID 5zhx-A PDB Code 5zhx Chain A click to enlarge Title Crystal structure of SmgGDS-558 and farnesylated RhoA complex Classification ONCOPROTEIN Compound Rap1 GTPase-GDP dissociation stimulator 1 Source (RHOA_HUMAN) Sequence A:  DAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHSLQAQ LINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLAELESS KEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAEND AIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDL MVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLA GALAIANFARNDANCIHMVDNGIVEKLMDLLDRHVEDGNV TVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEM PPVQFKLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCE AKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSGGIKHL VTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLV QILHRLLADERSAPEIKYNSMVLICALMGSECLHKEVQDL AFLDVVSKLRSHENKSVAQQASLTEQRLT Description (1)  Rap1 GTPase-GDP dissociation stimulator 1 Functional site 1) chain A residue 117 type sequence C description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1 2) chain A residue 118 type sequence Y description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1 3) chain A residue 124 type sequence Q description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1 4) chain A residue 127 type sequence L description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1 5) chain A residue 136 type sequence L description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1 6) chain A residue 152 type sequence M description binding site for Di-peptide FAR e 201 and CYS e 190 source : AC1

Display surface Download Links