eF-site ID 5zba-D PDB Code 5zba Chain D click to enlarge Title Crystal structure of Rtt109-Asf1-H3-H4-CoA complex Classification TRANSFERASE/STRUCTURAL PROTEIN Compound DNA damage response protein Rtt109, putative Source (H4_YEAST) Sequence D:  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKS FLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGF G Description Functional site 1) chain D residue 95 type sequence R description binding site for residue IOD A 608 source : AC5 2) chain D residue 47 type sequence S description binding site for residue IOD C 210 source : AE2 3) chain D residue 35 type sequence R description binding site for residue IOD C 212 source : AE4 4) chain D residue 30 type sequence T description binding site for residue IOD D 201 source : AE6 5) chain D residue 47 type sequence S description binding site for residue IOD D 203 source : AE7 6) chain D residue 49 type sequence L description binding site for residue IOD D 203 source : AE7 7) chain D residue 79 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:16768447 source Swiss-Prot : SWS_FT_FI8 8) chain D residue 91 type MOD_RES sequence K description N6-glutaryllysine => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI9 9) chain D residue 77 type MOD_RES sequence K description N6-succinyllysine => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 10) chain D residue 31 type MOD_RES sequence K description N6-succinyllysine => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 11) chain D residue 55 type MOD_RES sequence R description Omega-N-methylarginine => ECO:0000269|PubMed:19113941 source Swiss-Prot : SWS_FT_FI5 12) chain D residue 60 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI6 13) chain D residue 64 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:17287358, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links