eF-site ID 5z83-AB
PDB Code 5z83
Chain A, B

click to enlarge
Title Crystal structure of GenB1 from Micromonospora echinospora in complex with PLP (internal aldimine)
Classification TRANSFERASE
Compound C-6' aminotransferase
Source (Q70KD9_MICEC)
Sequence A:  KLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFD
NARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSL
LGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVL
SSGYHGYDPMWHCDEPFTPNQHGIVEFLFDLDVLAEWLSR
PEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEV
KVGLRYRAGLSTPLLDPAVWIVAKCLANGSPVAAVGGDAH
LLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIRA
AGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD
AFHAAAAAEGLLFFEGDNQTPSAAFTDEVVEDACGRIDRV
SAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETT
AIVERLWE
B:  KLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFD
NARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSL
LGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVL
SSGYHGYDPMWHCDEPFTPNQHGIVEFLFDLDVLAEWLSR
PEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEV
KVGLRYRAGLSTPLLDPAVWIVAKCLANGSPVAAVGGDAH
LLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIRA
AGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD
AFHAAAAAEGLLFFEGDNQTPSAAFTDEVVEDACGRIDRV
SAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETT
AIVERLWE
Description (1)  C-6' aminotransferase


Functional site

1) chain A
residue 106
type
ligand
sequence T
description binding site for residue PLP A 501
source : AC1

2) chain A
residue 107
type
ligand
sequence G
description binding site for residue PLP A 501
source : AC1

3) chain A
residue 108
type
ligand
sequence T
description binding site for residue PLP A 501
source : AC1

4) chain A
residue 132
type
ligand
sequence Y
description binding site for residue PLP A 501
source : AC1

5) chain A
residue 133
type
ligand
sequence H
description binding site for residue PLP A 501
source : AC1

6) chain A
residue 178
type
ligand
sequence S
description binding site for residue PLP A 501
source : AC1

7) chain A
residue 206
type
ligand
sequence D
description binding site for residue PLP A 501
source : AC1

8) chain A
residue 208
type
ligand
sequence V
description binding site for residue PLP A 501
source : AC1

9) chain A
residue 209
type
ligand
sequence K
description binding site for residue PLP A 501
source : AC1

10) chain A
residue 232
type
ligand
sequence K
description binding site for residue PLP A 501
source : AC1

11) chain B
residue 258
type
ligand
sequence F
description binding site for residue PLP A 501
source : AC1

12) chain B
residue 259
type
ligand
sequence T
description binding site for residue PLP A 501
source : AC1

13) chain A
residue 345
type
ligand
sequence D
description binding site for residue MG A 502
source : AC2

14) chain B
residue 345
type
ligand
sequence D
description binding site for residue MG B 502
source : AC3

15) chain A
residue 258
type
ligand
sequence F
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

16) chain A
residue 259
type
ligand
sequence T
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

17) chain B
residue 51
type
ligand
sequence R
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

18) chain B
residue 53
type
ligand
sequence S
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

19) chain B
residue 106
type
ligand
sequence T
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

20) chain B
residue 107
type
ligand
sequence G
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

21) chain B
residue 108
type
ligand
sequence T
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

22) chain B
residue 132
type
ligand
sequence Y
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

23) chain B
residue 133
type
ligand
sequence H
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

24) chain B
residue 178
type
ligand
sequence S
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

25) chain B
residue 206
type
ligand
sequence D
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

26) chain B
residue 208
type
ligand
sequence V
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

27) chain B
residue 209
type
ligand
sequence K
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

28) chain B
residue 231
type
ligand
sequence A
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

29) chain B
residue 233
type
ligand
sequence C
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

30) chain B
residue 234
type
ligand
sequence L
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

31) chain A
residue 106-108
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence TGT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

32) chain A
residue 111
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

33) chain A
residue 132-135
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence YHGY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

34) chain A
residue 178
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence S
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

35) chain A
residue 206
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

36) chain A
residue 208-209
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence VK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

37) chain A
residue 232
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence K
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

38) chain B
residue 257-259
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SFT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

39) chain A
residue 257-259
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SFT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

40) chain B
residue 106-108
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence TGT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

41) chain B
residue 111
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

42) chain B
residue 132-135
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence YHGY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

43) chain B
residue 178
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence S
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

44) chain B
residue 206
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

45) chain B
residue 208-209
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence VK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501

46) chain B
residue 232
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence K
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501


Display surface

Download
Links