eF-site ID 5z83-A
PDB Code 5z83
Chain A

click to enlarge
Title Crystal structure of GenB1 from Micromonospora echinospora in complex with PLP (internal aldimine)
Classification TRANSFERASE
Compound C-6' aminotransferase
Source (Q70KD9_MICEC)
Sequence A:  KLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFD
NARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSL
LGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVL
SSGYHGYDPMWHCDEPFTPNQHGIVEFLFDLDVLAEWLSR
PEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEV
KVGLRYRAGLSTPLLDPAVWIVAKCLANGSPVAAVGGDAH
LLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIRA
AGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD
AFHAAAAAEGLLFFEGDNQTPSAAFTDEVVEDACGRIDRV
SAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETT
AIVERLWE
Description (1)  C-6' aminotransferase


Functional site

1) chain A
residue 106
type
ligand
sequence T
description binding site for residue PLP A 501
source : AC1

2) chain A
residue 107
type
ligand
sequence G
description binding site for residue PLP A 501
source : AC1

3) chain A
residue 108
type
ligand
sequence T
description binding site for residue PLP A 501
source : AC1

4) chain A
residue 132
type
ligand
sequence Y
description binding site for residue PLP A 501
source : AC1

5) chain A
residue 133
type
ligand
sequence H
description binding site for residue PLP A 501
source : AC1

6) chain A
residue 178
type
ligand
sequence S
description binding site for residue PLP A 501
source : AC1

7) chain A
residue 206
type
ligand
sequence D
description binding site for residue PLP A 501
source : AC1

8) chain A
residue 208
type
ligand
sequence V
description binding site for residue PLP A 501
source : AC1

9) chain A
residue 209
type
ligand
sequence K
description binding site for residue PLP A 501
source : AC1

10) chain A
residue 232
type
ligand
sequence K
description binding site for residue PLP A 501
source : AC1

11) chain A
residue 345
type
ligand
sequence D
description binding site for residue MG A 502
source : AC2

12) chain A
residue 258
type
ligand
sequence F
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

13) chain A
residue 259
type
ligand
sequence T
description binding site for Di-peptide PLP B 501 and LYS B 232
source : AC4

14) chain A
residue 106-108
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence TGT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

15) chain A
residue 111
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence L
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

16) chain A
residue 132-135
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence YHGY
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

17) chain A
residue 178
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence S
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

18) chain A
residue 206
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence D
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

19) chain A
residue 208-209
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence VK
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

20) chain A
residue 232
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence K
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_A_501

21) chain A
residue 257-259
type binding
ligand PLP: PYRIDOXAL-5'-PHOSPHATE
sequence SFT
description PYRIDOXAL-5'-PHOSPHATE binding site
source pdb_hetatom : PLP_5z83_B_501


Display surface

Download
Links