eF-site ID 5z3v-O PDB Code 5z3v Chain O click to enlarge Title Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state Classification STRUCTURAL PROTEIN/HYDROLASE/DNA Compound Transcription regulatory protein SNF2 Source (5Z3V) Sequence O:  LLDQTKDTRITHLLRQTNAFLDYYNVAHRIKEDIKKQPSI LVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQ TISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPT LRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERA LLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLI LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFD KIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKV EKVVKCKMSALQQIMYQQMLKYRGFNNQIMQLKKICNHPF VFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATG HRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERS ELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDT DWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILE RAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEE RRKKREEELKDSEINEILARNDEEMAVLTRMDEDRSKKEK SRLREESESAAVYNGR Description Functional site 1) chain O residue 766 type sequence T description binding site for residue ADP O 1501 source : AC1 2) chain O residue 768 type sequence K description binding site for residue ADP O 1501 source : AC1 3) chain O residue 770 type sequence Y description binding site for residue ADP O 1501 source : AC1 4) chain O residue 795 type sequence G description binding site for residue ADP O 1501 source : AC1 5) chain O residue 797 type sequence G description binding site for residue ADP O 1501 source : AC1 6) chain O residue 798 type sequence K description binding site for residue ADP O 1501 source : AC1 7) chain O residue 799 type sequence T description binding site for residue ADP O 1501 source : AC1 8) chain O residue 800 type sequence I description binding site for residue ADP O 1501 source : AC1 9) chain O residue 838 type sequence W description binding site for residue ADP O 1501 source : AC1 10) chain O residue 1171 type sequence N description binding site for residue ADP O 1501 source : AC1 11) chain O residue 1173 type sequence Q description binding site for residue ADP O 1501 source : AC1 12) chain O residue 1200 type sequence I description binding site for residue ADP O 1501 source : AC1 13) chain O residue 1171 type sequence N description binding site for residue BEF O 1502 source : AC2 14) chain O residue 1196 type sequence R description binding site for residue BEF O 1502 source : AC2 15) chain O residue 1199 type sequence R description binding site for residue BEF O 1502 source : AC2 16) chain O residue 895 type sequence E description binding site for residue MG O 1503 source : AC3

Display surface Download Links