eF-site ID 5z3v-H
PDB Code 5z3v
Chain H

click to enlarge
Title Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state
Classification STRUCTURAL PROTEIN/HYDROLASE/DNA
Compound Transcription regulatory protein SNF2
Source (5Z3V)
Sequence H:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE
RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
Description (1)  Transcription regulatory protein SNF2, Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex

Display surface

Download
Links