eF-site ID 5z3v-ABCDEFGHO
PDB Code 5z3v
Chain A, B, C, D, E, F, G, H, O

click to enlarge
Title Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state
Classification STRUCTURAL PROTEIN/HYDROLASE/DNA
Compound Transcription regulatory protein SNF2
Source (5Z3V)
Sequence A:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGER
B:  KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FG
C:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
D:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE
RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
E:  RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI
MPKDIQLARRIRGER
F:  AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEET
RGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
G:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
H:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE
RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
O:  LLDQTKDTRITHLLRQTNAFLDYYNVAHRIKEDIKKQPSI
LVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQ
TISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPT
LRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERA
LLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLI
LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFD
KIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKV
EKVVKCKMSALQQIMYQQMLKYRGFNNQIMQLKKICNHPF
VFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATG
HRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERS
ELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDT
DWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILE
RAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEE
RRKKREEELKDSEINEILARNDEEMAVLTRMDEDRSKKEK
SRLREESESAAVYNGR
Description (1)  Transcription regulatory protein SNF2, Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex


Functional site

1) chain O
residue 766
type
ligand
sequence T
description binding site for residue ADP O 1501
source : AC1

2) chain O
residue 768
type
ligand
sequence K
description binding site for residue ADP O 1501
source : AC1

3) chain O
residue 770
type
ligand
sequence Y
description binding site for residue ADP O 1501
source : AC1

4) chain O
residue 795
type
ligand
sequence G
description binding site for residue ADP O 1501
source : AC1

5) chain O
residue 797
type
ligand
sequence G
description binding site for residue ADP O 1501
source : AC1

6) chain O
residue 798
type
ligand
sequence K
description binding site for residue ADP O 1501
source : AC1

7) chain O
residue 799
type
ligand
sequence T
description binding site for residue ADP O 1501
source : AC1

8) chain O
residue 800
type
ligand
sequence I
description binding site for residue ADP O 1501
source : AC1

9) chain O
residue 838
type
ligand
sequence W
description binding site for residue ADP O 1501
source : AC1

10) chain O
residue 1171
type
ligand
sequence N
description binding site for residue ADP O 1501
source : AC1

11) chain O
residue 1173
type
ligand
sequence Q
description binding site for residue ADP O 1501
source : AC1

12) chain O
residue 1200
type
ligand
sequence I
description binding site for residue ADP O 1501
source : AC1

13) chain O
residue 1171
type
ligand
sequence N
description binding site for residue BEF O 1502
source : AC2

14) chain O
residue 1196
type
ligand
sequence R
description binding site for residue BEF O 1502
source : AC2

15) chain O
residue 1199
type
ligand
sequence R
description binding site for residue BEF O 1502
source : AC2

16) chain O
residue 895
type
ligand
sequence E
description binding site for residue MG O 1503
source : AC3

17) chain O
residue 766-768
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence TLK
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

18) chain O
residue 770
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence Y
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

19) chain O
residue 792
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence D
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

20) chain O
residue 794-800
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence MGLGKTI
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

21) chain O
residue 834
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

22) chain O
residue 838
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence W
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

23) chain O
residue 1171
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

24) chain O
residue 1173
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence Q
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

25) chain O
residue 1199-1200
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence RI
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_5z3v_O_1501

26) chain O
residue 794-795
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence MG
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_5z3v_O_1502

27) chain O
residue 895
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence E
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_5z3v_O_1502

28) chain O
residue 1170-1171
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence LN
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_5z3v_O_1502

29) chain O
residue 1196
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence R
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_5z3v_O_1502

30) chain O
residue 1199
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence R
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_5z3v_O_1502


Display surface

Download
Links