eF-site ID 5z3v-ABCDEFGHO
PDB Code 5z3v
Chain A, B, C, D, E, F, G, H, O

click to enlarge
Title Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state
Classification STRUCTURAL PROTEIN/HYDROLASE/DNA
Compound Transcription regulatory protein SNF2
Source (5Z3V)
Sequence A:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGER
B:  KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FG
C:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
D:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE
RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
E:  RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI
MPKDIQLARRIRGER
F:  AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEET
RGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
G:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
H:  TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFE
RIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
O:  LLDQTKDTRITHLLRQTNAFLDYYNVAHRIKEDIKKQPSI
LVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQ
TISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPT
LRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERA
LLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLI
LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFD
KIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKV
EKVVKCKMSALQQIMYQQMLKYRGFNNQIMQLKKICNHPF
VFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATG
HRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERS
ELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDT
DWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILE
RAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEE
RRKKREEELKDSEINEILARNDEEMAVLTRMDEDRSKKEK
SRLREESESAAVYNGR
Description (1)  Transcription regulatory protein SNF2, Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex


Functional site

1) chain O
residue 766
type
ligand
sequence T
description binding site for residue ADP O 1501
source : AC1

2) chain O
residue 768
type
ligand
sequence K
description binding site for residue ADP O 1501
source : AC1

3) chain O
residue 770
type
ligand
sequence Y
description binding site for residue ADP O 1501
source : AC1

4) chain O
residue 795
type
ligand
sequence G
description binding site for residue ADP O 1501
source : AC1

5) chain O
residue 797
type
ligand
sequence G
description binding site for residue ADP O 1501
source : AC1

6) chain O
residue 798
type
ligand
sequence K
description binding site for residue ADP O 1501
source : AC1

7) chain O
residue 799
type
ligand
sequence T
description binding site for residue ADP O 1501
source : AC1

8) chain O
residue 800
type
ligand
sequence I
description binding site for residue ADP O 1501
source : AC1

9) chain O
residue 838
type
ligand
sequence W
description binding site for residue ADP O 1501
source : AC1

10) chain O
residue 1171
type
ligand
sequence N
description binding site for residue ADP O 1501
source : AC1

11) chain O
residue 1173
type
ligand
sequence Q
description binding site for residue ADP O 1501
source : AC1

12) chain O
residue 1200
type
ligand
sequence I
description binding site for residue ADP O 1501
source : AC1

13) chain O
residue 1171
type
ligand
sequence N
description binding site for residue BEF O 1502
source : AC2

14) chain O
residue 1196
type
ligand
sequence R
description binding site for residue BEF O 1502
source : AC2

15) chain O
residue 1199
type
ligand
sequence R
description binding site for residue BEF O 1502
source : AC2

16) chain O
residue 895
type
ligand
sequence E
description binding site for residue MG O 1503
source : AC3

17) chain A
residue 66-74
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959

18) chain E
residue 66-74
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959

19) chain C
residue 21-27
type prosite
ligand
sequence AGLQFPV
description Histone H2A signature.[AC]-G-L-x-F-P-V.
source prosite : PS00046

20) chain G
residue 21-27
type prosite
ligand
sequence AGLQFPV
description Histone H2A signature.[AC]-G-L-x-F-P-V.
source prosite : PS00046

21) chain D
residue 89-111
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature.[KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A-[LIVM]-[STA]-E-G.
source prosite : PS00357

22) chain H
residue 89-111
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature.[KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A-[LIVM]-[STA]-E-G.
source prosite : PS00357


Display surface

Download
Links