eF-site ID 5z3v-A
PDB Code 5z3v
Chain A

click to enlarge
Title Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state
Classification STRUCTURAL PROTEIN/HYDROLASE/DNA
Compound Transcription regulatory protein SNF2
Source (5Z3V)
Sequence A:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGER
Description (1)  Transcription regulatory protein SNF2, Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex


Functional site

1) chain A
residue 66-74
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959


Display surface

Download
Links