eF-site ID 5z3l-A
PDB Code 5z3l
Chain A

click to enlarge
Title Structure of Snf2-nucleosome complex in apo state
Classification STRUCTURAL PROTEIN/HYDROLASE/DNA
Compound Histone H3.2
Source (SNF2_YEAST)
Sequence A:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGER
Description (1)  Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1, Transcription regulatory protein SNF2/DNA Complex

Display surface

Download
Links