eF-site ID 5z3l-B PDB Code 5z3l Chain B click to enlarge Title Structure of Snf2-nucleosome complex in apo state Classification STRUCTURAL PROTEIN/HYDROLASE/DNA Compound Histone H3.2 Source (SNF2_YEAST) Sequence B:  AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEET RGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG RTLYGFG Description Functional site 1) chain B residue 59 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI10 2) chain B residue 77 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI11 3) chain B residue 51 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI9 4) chain B residue 88 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI9 5) chain B residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI12 6) chain B residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links