eF-site ID 5yxj-A PDB Code 5yxj Chain A click to enlarge Title FXR ligand binding domain Classification NUCLEAR PROTEIN Compound Bile acid receptor Source (E7EWM1_HUMAN) Sequence A:  ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEEN FLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGS AVEAMFLRSAEIFNKSGHSDLLEERIRNSGISDEYITPMF SFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHH HAEMLMSWRVNDHKFTPLLCEIWDV Description Functional site 1) chain A residue 294 type sequence H description binding site for residue 93U A 501 source : AC1 2) chain A residue 328 type sequence M description binding site for residue 93U A 501 source : AC1 3) chain A residue 329 type sequence F description binding site for residue 93U A 501 source : AC1 4) chain A residue 332 type sequence S description binding site for residue 93U A 501 source : AC1 5) chain A residue 357 type sequence I description binding site for residue 93U A 501 source : AC1 6) chain A residue 362 type sequence I description binding site for residue 93U A 501 source : AC1 7) chain A residue 365 type sequence M description binding site for residue 93U A 501 source : AC1 8) chain A residue 369 type sequence Y description binding site for residue 93U A 501 source : AC1 9) chain A residue 447 type sequence H description binding site for residue 93U A 501 source : AC1 10) chain A residue 450 type sequence M description binding site for residue 93U A 501 source : AC1 11) chain A residue 451 type sequence L description binding site for residue 93U A 501 source : AC1 12) chain A residue 469 type sequence W description binding site for residue 93U A 501 source : AC1 13) chain A residue 331 type BINDING sequence R description BINDING => ECO:0007744|PDB:6HL1 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 361 type BINDING sequence Y description BINDING => ECO:0007744|PDB:6HL1 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 369 type BINDING sequence Y description BINDING => ECO:0007744|PDB:6HL1 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 447 type BINDING sequence H description BINDING => ECO:0007744|PDB:6HL1 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 442 type MOD_RES sequence T description Phosphothreonine; by PKC/PRKCZ => ECO:0000305|PubMed:18668687 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 275 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) => ECO:0000305|PubMed:23546875 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links