eF-site ID 5yu9-B PDB Code 5yu9 Chain B click to enlarge Title Crystal structure of EGFR 696-1022 T790M in complex with Ibrutinib Classification ONCOPROTEIN Compound Epidermal growth factor receptor Source Homo sapiens (Human) (EGFR_HUMAN) Sequence B:  PNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKV KIPVAIKELREANKEILDEAYVMASVDNPHVCRLLGICLT STVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAK GMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLV PIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYD GIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDAD SRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSN FYRALMDEEDMDDVV Description Functional site 1) chain B residue 743 type sequence A description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 2) chain B residue 745 type sequence K description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 3) chain B residue 766 type sequence M description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 4) chain B residue 790 type sequence M description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 5) chain B residue 791 type sequence Q description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 6) chain B residue 793 type sequence M description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 7) chain B residue 796 type sequence G description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 8) chain B residue 798 type sequence L description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 9) chain B residue 799 type sequence L description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 10) chain B residue 800 type sequence D description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 11) chain B residue 801 type sequence Y description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 12) chain B residue 841 type sequence R description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 13) chain B residue 843 type sequence V description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 14) chain B residue 854 type sequence T description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 15) chain B residue 855 type sequence D description binding site for Di-peptide 1E8 B 1101 and CYS B 797 source : AC4 16) chain B residue 837 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 17) chain B residue 745 type BINDING sequence K description BINDING => ECO:0000269|PubMed:17349580, ECO:0000269|PubMed:19563760, ECO:0007744|PDB:2EB3, ECO:0007744|PDB:2GS7, ECO:0007744|PDB:2ITN, ECO:0007744|PDB:3GT8, ECO:0007744|PDB:3VJN, ECO:0007744|PDB:3VJO, ECO:0007744|PDB:4RIW, ECO:0007744|PDB:4RIY, ECO:0007744|PDB:4ZSE, ECO:0007744|PDB:5CNN, ECO:0007744|PDB:5CNO, ECO:0007744|PDB:5D41 source Swiss-Prot : SWS_FT_FI3 18) chain B residue 718 type BINDING sequence L description BINDING => ECO:0000269|PubMed:19563760, ECO:0007744|PDB:2GS7, ECO:0007744|PDB:3GT8, ECO:0007744|PDB:4ZSE, ECO:0007744|PDB:5CNN, ECO:0007744|PDB:5CNO, ECO:0007744|PDB:5D41 source Swiss-Prot : SWS_FT_FI2 19) chain B residue 790 type BINDING sequence M description BINDING => ECO:0000269|PubMed:17349580, ECO:0000269|PubMed:19563760, ECO:0007744|PDB:2EB3, ECO:0007744|PDB:2GS7, ECO:0007744|PDB:2ITN, ECO:0007744|PDB:2ITV, ECO:0007744|PDB:2ITX, ECO:0007744|PDB:3GT8, ECO:0007744|PDB:3VJN, ECO:0007744|PDB:3VJO, ECO:0007744|PDB:4RIW, ECO:0007744|PDB:4RIX, ECO:0007744|PDB:4RIY, ECO:0007744|PDB:4ZSE, ECO:0007744|PDB:5CNN, ECO:0007744|PDB:5CNO, ECO:0007744|PDB:5D41 source Swiss-Prot : SWS_FT_FI4 20) chain B residue 855 type BINDING sequence D description BINDING => ECO:0000269|PubMed:17349580, ECO:0000269|PubMed:19563760, ECO:0007744|PDB:2EB3, ECO:0007744|PDB:2GS7, ECO:0007744|PDB:2ITN, ECO:0007744|PDB:2ITV, ECO:0007744|PDB:2ITX, ECO:0007744|PDB:3GT8, ECO:0007744|PDB:3VJN, ECO:0007744|PDB:4RIW, ECO:0007744|PDB:4RIX, ECO:0007744|PDB:4RIY, ECO:0007744|PDB:4ZSE, ECO:0007744|PDB:5CNN, ECO:0007744|PDB:5CNO, ECO:0007744|PDB:5D41 source Swiss-Prot : SWS_FT_FI5 21) chain B residue 991 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:16083266, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI9 22) chain B residue 745 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:29192674 source Swiss-Prot : SWS_FT_FI7 23) chain B residue 995 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI10 24) chain B residue 998 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:19563760, ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI11 25) chain B residue 929 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI14 26) chain B residue 970 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI14 27) chain B residue 757 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:33996800 source Swiss-Prot : SWS_FT_FI15 28) chain B residue 960 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:33996800 source Swiss-Prot : SWS_FT_FI15 29) chain B residue 716 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:33996800 source Swiss-Prot : SWS_FT_FI13 30) chain B residue 737 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:33996800 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links