eF-site ID 5yo5-ABCDEFGH PDB Code 5yo5 Chain A, B, C, D, E, F, G, H click to enlarge Title Crystal Structure of B562RIL with engineered disulfide bond A20C-Q25C Classification ELECTRON TRANSPORT Compound Soluble cytochrome b562 Source (C562_ECOLX) Sequence A:  AADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALD AQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLA NEGKVKEAQAAAEQLKTTRNAYIQKYL B:  ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDA QKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYIQKYL C:  AADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALD AQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLA NEGKVKEAQAAAEQLKTTRNAYIQKYL D:  ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDA QKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYIQKYL E:  ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDA QKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYIQKYL F:  ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDA QKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYIQKYL G:  DLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDAQ KATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANE GKVKEAQAAAEQLKTTRNAYIQKYL H:  ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDA QKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTRNAYIQKYL Description Functional site 1) chain A residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 2) chain E residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 3) chain F residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 4) chain F residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 5) chain G residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 6) chain G residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 7) chain H residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 8) chain H residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 9) chain A residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 10) chain B residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 11) chain B residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 12) chain C residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 13) chain C residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 14) chain D residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1 15) chain D residue 102 type BINDING sequence I description axial binding residue source Swiss-Prot : SWS_FT_FI1 16) chain E residue 7 type BINDING sequence W description axial binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links