eF-site ID 5ykn-A PDB Code 5ykn Chain A click to enlarge Title crystal structure of Arabidopsis thaliana JMJ14 catalytic domain Classification GENE REGULATION Compound Probable lysine-specific demethylase JMJ14 Source null (JMJ14_ARATH) Sequence A:  RWNPSEACRPLVDDAPIFYPTNEDFDDPLGYIEKLRSKAE SYGICRIVPPVAWRPPCPLKEKKIWENSKFPTRIQFIDLL QNRFGFQTGPDFTLAAFQKYDEYFKECYFQPKVKDLEGEY WRIVEQATDEVEVYYGADLETKKFGSGFPKYKPGYPISEA DQYSQCGWNLNNLSRLPGSVLAFESCDISGVIVPWLYVGM CFSTFCWHVEDHHLYSMNYLHTGDPKVWYGIPGNHAESFE NVMKKRLPDLFEEQPDLLHQLVTQLSPRILKEEGVPVYRA VQRSGEFILTFPKAYHSGFNCGFNCAEAVNVAPVDWLVHG QNAVEGYSKQRRKSSLSHDKLLLGAAMEATYCLWELSLSK KKTPVIARWKRVCSEDGLLTKAVKKRVQMEEERLNHLQDG FSLRKMRECFLCFYDLHMSASSCKCSPNRFACLIHAKDLC SCESKDRYILIRHTLDELWALVRALEGDLDAIDLWASK Description Functional site 1) chain A residue 309 type sequence H description binding site for residue NI A 800 source : AC1 2) chain A residue 311 type sequence E description binding site for residue NI A 800 source : AC1 3) chain A residue 397 type sequence H description binding site for residue NI A 800 source : AC1 4) chain A residue 519 type sequence C description binding site for residue ZN A 801 source : AC2 5) chain A residue 522 type sequence C description binding site for residue ZN A 801 source : AC2 6) chain A residue 542 type sequence C description binding site for residue ZN A 801 source : AC2 7) chain A residue 545 type sequence H description binding site for residue ZN A 801 source : AC2 8) chain A residue 533 type sequence C description binding site for residue ZN A 802 source : AC3 9) chain A residue 535 type sequence C description binding site for residue ZN A 802 source : AC3 10) chain A residue 550 type sequence C description binding site for residue ZN A 802 source : AC3 11) chain A residue 552 type sequence C description binding site for residue ZN A 802 source : AC3 12) chain A residue 285 type SITE sequence E description Involved in histone H3R2 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI7 13) chain A residue 290 type SITE sequence S description Involved in histone H3K4me3 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI8 14) chain A residue 298 type SITE sequence Y description Involved in histone H3K4me3 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI8 15) chain A residue 312 type SITE sequence D description Involved in histone H3Q5 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI9 16) chain A residue 309 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00538, ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI2 17) chain A residue 311 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00538, ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI2 18) chain A residue 397 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00538, ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI2 19) chain A residue 542 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 20) chain A residue 545 type BINDING sequence H description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 21) chain A residue 519 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 22) chain A residue 522 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 23) chain A residue 533 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 24) chain A residue 535 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI3 25) chain A residue 550 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI4 26) chain A residue 552 type BINDING sequence C description BINDING => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN source Swiss-Prot : SWS_FT_FI5 27) chain A residue 363 type SITE sequence V description Involved in histone H3A7 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI6 28) chain A residue 171 type SITE sequence F description Involved in histone H3A7 recognition => ECO:0000269|PubMed:29233856, ECO:0007744|PDB:5YKN, ECO:0007744|PDB:5YKO source Swiss-Prot : SWS_FT_FI6 29) chain A residue 519-571 type ZN_FING sequence CFLCFYDLHMSASSCKCSPNRFACLIHAKDLCSCESKDRY ILIRHTLDELWAL description C5HC2 => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links