eF-site ID 5ya5-A PDB Code 5ya5 Chain A click to enlarge Title CRYSTAL STRUCTURE OF c-MET IN COMPLEX WITH NOVEL INHIBITOR Classification TRANSFERASE/INHIBITOR Compound Hepatocyte growth factor receptor Source (MET_HUMAN) Sequence A:  ALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGT LLKKIHCAVKSLNRSQFLTEGIIMKDFSHPNVLSLLGICS PLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGM KYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDK EYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVL LWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPL YEVMLKCWHPKAEMRPSFSELVSRISAIFSTFI Description Functional site 1) chain A residue 1108 type sequence A description binding site for residue 6TD A 1401 source : AC1 2) chain A residue 1159 type sequence Y description binding site for residue 6TD A 1401 source : AC1 3) chain A residue 1160 type sequence M description binding site for residue 6TD A 1401 source : AC1 4) chain A residue 1164 type sequence D description binding site for residue 6TD A 1401 source : AC1 5) chain A residue 1167 type sequence N description binding site for residue 6TD A 1401 source : AC1 6) chain A residue 1208 type sequence R description binding site for residue 6TD A 1401 source : AC1 7) chain A residue 1211 type sequence M description binding site for residue 6TD A 1401 source : AC1 8) chain A residue 1221 type sequence A description binding site for residue 6TD A 1401 source : AC1 9) chain A residue 1222 type sequence D description binding site for residue 6TD A 1401 source : AC1 10) chain A residue 1226 type sequence A description binding site for residue 6TD A 1401 source : AC1 11) chain A residue 1230 type sequence Y description binding site for residue 6TD A 1401 source : AC1 12) chain A residue 1200-1212 type prosite sequence FVHRDLAARNCML description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FVHrDLAARNCML source prosite : PS00109 13) chain A residue 1289 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI7 14) chain A residue 1084-1110 type prosite sequence IGRGHFGCVYHGTLLKKIHCAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGRGHFGCVYhGtlldndgkkih.......CAVK source prosite : PS00107 15) chain A residue 1110 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 16) chain A residue 1204 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 1084 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 1230 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:12475979 source Swiss-Prot : SWS_FT_FI4 19) chain A residue 1234 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:12475979 source Swiss-Prot : SWS_FT_FI5 20) chain A residue 1235 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:12475979, ECO:0000269|PubMed:1655790 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links