eF-site ID 5xun-A
PDB Code 5xun
Chain A

click to enlarge
Title Crystal structure of Y145F mutant of KacT
Classification TOXIN
Compound Acetyltransferase
Source (A0A081LU80_KLEPN)
Sequence A:  QQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDG
QILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQQK
KIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWG
ASKAVGIYGLFVEALNEKAKAFFLRLGFIQLVDENSNLLF
YPTKSIEQLF
Description (1)  Acetyltransferase


Functional site

1) chain A
residue 23
type
ligand
sequence C
description binding site for residue ACO A 201
source : AC1

2) chain A
residue 25
type
ligand
sequence E
description binding site for residue ACO A 201
source : AC1

3) chain A
residue 28
type
ligand
sequence L
description binding site for residue ACO A 201
source : AC1

4) chain A
residue 83
type
ligand
sequence K
description binding site for residue ACO A 201
source : AC1

5) chain A
residue 94
type
ligand
sequence L
description binding site for residue ACO A 201
source : AC1

6) chain A
residue 95
type
ligand
sequence G
description binding site for residue ACO A 201
source : AC1

7) chain A
residue 96
type
ligand
sequence R
description binding site for residue ACO A 201
source : AC1

8) chain A
residue 97
type
ligand
sequence L
description binding site for residue ACO A 201
source : AC1

9) chain A
residue 98
type
ligand
sequence A
description binding site for residue ACO A 201
source : AC1

10) chain A
residue 99
type
ligand
sequence I
description binding site for residue ACO A 201
source : AC1

11) chain A
residue 104
type
ligand
sequence Q
description binding site for residue ACO A 201
source : AC1

12) chain A
residue 105
type
ligand
sequence G
description binding site for residue ACO A 201
source : AC1

13) chain A
residue 106
type
ligand
sequence Q
description binding site for residue ACO A 201
source : AC1

14) chain A
residue 107
type
ligand
sequence G
description binding site for residue ACO A 201
source : AC1

15) chain A
residue 108
type
ligand
sequence W
description binding site for residue ACO A 201
source : AC1

16) chain A
residue 109
type
ligand
sequence G
description binding site for residue ACO A 201
source : AC1

17) chain A
residue 110
type
ligand
sequence E
description binding site for residue ACO A 201
source : AC1

18) chain A
residue 134
type
ligand
sequence V
description binding site for residue ACO A 201
source : AC1

19) chain A
residue 135
type
ligand
sequence E
description binding site for residue ACO A 201
source : AC1

20) chain A
residue 140
type
ligand
sequence K
description binding site for residue ACO A 201
source : AC1

21) chain A
residue 141
type
ligand
sequence A
description binding site for residue ACO A 201
source : AC1

22) chain A
residue 143
type
ligand
sequence A
description binding site for residue ACO A 201
source : AC1

23) chain A
residue 144
type
ligand
sequence F
description binding site for residue ACO A 201
source : AC1

24) chain A
residue 147
type
ligand
sequence R
description binding site for residue ACO A 201
source : AC1

25) chain A
residue 166
type
ligand
sequence K
description binding site for residue ACO A 201
source : AC1

26) chain A
residue 123
type
ligand
sequence A
description binding site for residue ACT A 202
source : AC2

27) chain A
residue 127
type
ligand
sequence V
description binding site for residue ACT A 202
source : AC2

28) chain A
residue 129
type
ligand
sequence I
description binding site for residue ACT A 202
source : AC2


Display surface

Download
Links