eF-site ID 5xb5-B
PDB Code 5xb5
Chain B

click to enlarge
Title Crystal structure of R90A mutant of thymidylate kinase (aq_969) from Aquifex Aeolicus VF5
Classification TRANSFERASE
Compound Thymidylate kinase
Source Aquifex aeolicus (strain VF5) (KTHY_AQUAE)
Sequence B:  MLIAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGT
KVGEVLREILLTEELDERTELLLFEASRSKLIEEKIIPDL
KRDKVVILDAFVLSTIAYQGYGKGLDVEFIKNLNEFATRG
VKPDITLLLDIPVDIALRRLKEKNRFENKEFLEKVRKGFL
ELAKEEENVVVIDASGEEEEVFKEILRALSGV
Description (1)  Thymidylate kinase (E.C.2.7.4.9)


Functional site

1) chain B
residue 10
type
ligand
sequence G
description binding site for residue PO4 B 201
source : AC2

2) chain B
residue 11
type
ligand
sequence S
description binding site for residue PO4 B 201
source : AC2

3) chain B
residue 12
type
ligand
sequence G
description binding site for residue PO4 B 201
source : AC2

4) chain B
residue 13
type
ligand
sequence K
description binding site for residue PO4 B 201
source : AC2

5) chain B
residue 14
type
ligand
sequence T
description binding site for residue PO4 B 201
source : AC2

6) chain B
residue 7-14
type NP_BIND
ligand
sequence GIDGSGKT
description ATP. {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links