eF-site ID 5x7y-D PDB Code 5x7y Chain D click to enlarge Title Crystal Structure of the Dog Lipocalin Allergen Can f 6 Classification ALLERGEN Compound Lipocalin-Can f 6 allergen Source (H2B3G5_CANLF) Sequence D:  DVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK DIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDV VHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGR KPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQ Description Functional site 1) chain D residue 40 type sequence M description binding site for residue PEG D 201 source : AC4 2) chain D residue 42 type sequence V description binding site for residue PEG D 201 source : AC4 3) chain D residue 121 type sequence E description binding site for residue PEG D 201 source : AC4 4) chain D residue 123 type sequence Y description binding site for residue PEG D 201 source : AC4 5) chain D residue 37 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 6) chain D residue 52 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 7) chain D residue 75 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links