eF-site ID 5x7y-C PDB Code 5x7y Chain C click to enlarge Title Crystal Structure of the Dog Lipocalin Allergen Can f 6 Classification ALLERGEN Compound Lipocalin-Can f 6 allergen Source (H2B3G5_CANLF) Sequence C:  NDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFV KDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYD VVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYG RKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQAR Description Functional site 1) chain C residue 40 type sequence M description binding site for residue PEG C 201 source : AC3 2) chain C residue 42 type sequence V description binding site for residue PEG C 201 source : AC3 3) chain C residue 57 type sequence F description binding site for residue PEG C 201 source : AC3 4) chain C residue 121 type sequence E description binding site for residue PEG C 201 source : AC3 5) chain C residue 37 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 6) chain C residue 52 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 7) chain C residue 75 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links