eF-site ID 5x7y-A PDB Code 5x7y Chain A click to enlarge Title Crystal Structure of the Dog Lipocalin Allergen Can f 6 Classification ALLERGEN Compound Lipocalin-Can f 6 allergen Source (H2B3G5_CANLF) Sequence A:  DVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK DIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDV VHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGR KPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQAR Description Functional site 1) chain A residue 40 type sequence M description binding site for residue PEG A 201 source : AC1 2) chain A residue 42 type sequence V description binding site for residue PEG A 201 source : AC1 3) chain A residue 57 type sequence F description binding site for residue PEG A 201 source : AC1 4) chain A residue 108 type sequence L description binding site for residue PEG A 201 source : AC1 5) chain A residue 121 type sequence E description binding site for residue PEG A 201 source : AC1 6) chain A residue 11-24 type prosite sequence NFDISKISGDWYSI description LIPOCALIN Lipocalin signature. NFDisKISGDWYSI source prosite : PS00213 7) chain A residue 37 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 52 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 75 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255|PROSITE-ProRule:PRU00498 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links