eF-site ID 5wzz-D PDB Code 5wzz Chain D click to enlarge Title The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating Wnt-induced Axin degradation Classification LIGASE Compound E3 ubiquitin-protein ligase SIAH1 Source Homo sapiens (Human) (AXIN1_HUMAN) Sequence D:  SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPG ASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINL PGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLI GTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIM NSDCLVFDTSIAQLFAENGNLGINVTISMC Description Functional site 1) chain D residue 98 type sequence C description binding site for residue ZN D 301 source : AC7 2) chain D residue 105 type sequence C description binding site for residue ZN D 301 source : AC7 3) chain D residue 117 type sequence H description binding site for residue ZN D 301 source : AC7 4) chain D residue 121 type sequence C description binding site for residue ZN D 301 source : AC7 5) chain D residue 128 type sequence C description binding site for residue ZN D 302 source : AC8 6) chain D residue 135 type sequence C description binding site for residue ZN D 302 source : AC8 7) chain D residue 147 type sequence H description binding site for residue ZN D 302 source : AC8 8) chain D residue 152 type sequence H description binding site for residue ZN D 302 source : AC8 9) chain D residue 93-153 type ZN_FING sequence SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPG ASCKWQGSLDAVMPHLMHQHK description SIAH-type => ECO:0000255|PROSITE-ProRule:PRU00455 source Swiss-Prot : SWS_FT_FI1 10) chain D residue 98 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 11) chain D residue 105 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 12) chain D residue 117 type BINDING sequence H description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 13) chain D residue 121 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 14) chain D residue 128 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 15) chain D residue 135 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 16) chain D residue 147 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 17) chain D residue 152 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3

Display surface Download Links