eF-site ID 5wzz-C PDB Code 5wzz Chain C click to enlarge Title The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating Wnt-induced Axin degradation Classification LIGASE Compound E3 ubiquitin-protein ligase SIAH1 Source Homo sapiens (Human) (AXIN1_HUMAN) Sequence C:  SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPG ASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINL PGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLI GTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIM NSDCLVFDTSIAQLFAENGNLGINVTISMC Description Functional site 1) chain C residue 98 type sequence C description binding site for residue ZN C 301 source : AC5 2) chain C residue 105 type sequence C description binding site for residue ZN C 301 source : AC5 3) chain C residue 117 type sequence H description binding site for residue ZN C 301 source : AC5 4) chain C residue 121 type sequence C description binding site for residue ZN C 301 source : AC5 5) chain C residue 128 type sequence C description binding site for residue ZN C 302 source : AC6 6) chain C residue 135 type sequence C description binding site for residue ZN C 302 source : AC6 7) chain C residue 147 type sequence H description binding site for residue ZN C 302 source : AC6 8) chain C residue 152 type sequence H description binding site for residue ZN C 302 source : AC6 9) chain C residue 93-153 type ZN_FING sequence SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPG ASCKWQGSLDAVMPHLMHQHK description SIAH-type => ECO:0000255|PROSITE-ProRule:PRU00455 source Swiss-Prot : SWS_FT_FI1 10) chain C residue 105 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 11) chain C residue 117 type BINDING sequence H description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 12) chain C residue 121 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 13) chain C residue 98 type BINDING sequence C description BINDING => ECO:0000269|PubMed:28546513, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI2 14) chain C residue 135 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 15) chain C residue 147 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 16) chain C residue 152 type BINDING sequence H description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3 17) chain C residue 128 type BINDING sequence C description BINDING => ECO:0000269|PubMed:16085652, ECO:0000269|PubMed:28546513, ECO:0007744|PDB:2A25, ECO:0007744|PDB:5WZZ source Swiss-Prot : SWS_FT_FI3

Display surface Download Links