eF-site ID 5wob-L
PDB Code 5wob
Chain L

click to enlarge
Title Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin
Classification HYDROLASE
Compound Insulin-degrading enzyme
Source (5WOB)
Sequence L:  MTQSPSSLSASVGDRVTITCRAVSSAVAWYQQKPGKAPKL
LIYSTSSLYSGVPSRFSGSRSTDFTLTISSLQPEDFATYY
CQQSSPSFLITFGQGTKVEIKRVAAPSVFIFPPSDSQLKS
SVVCLLNNFYPREAKVQWKSGNSQESVTEQDSKDSTYSLS
STLTYEKHKVTHQGLS
Description (1)  Insulin-degrading enzyme (E.C.3.4.24.56), Insulin, IDE-bound Fab, heavy chain, IDE-bound Fab, light chain

Display surface

Download
Links