eF-site ID 5wdh-A PDB Code 5wdh Chain A click to enlarge Title Motor domain of human kinesin family member C1 Classification MOTOR PROTEIN Compound Kinesin-like protein KIFC1 Source Homo sapiens (Human) (KIFC1_HUMAN) Sequence A:  GNIRVFCRVRPVLPGEPTPPPGLLLFPSGDPPTRLSLSRP RHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFA YGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQEL SGQGWTYSFVASYVEIYNETVRDLLATGECEIRRASEELT VTNARYVPVSCEKEVDALLHLARQNRAVARTRSSRSHSVF QLQISGEHSSRGLQCGAPLSLVDLAGSERSLSTLGLVIMA LSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEE NVSESLNSLRFASKVNQC Description Functional site 1) chain A residue 316 type sequence R description binding site for residue ADP A 801 source : AC1 2) chain A residue 318 type sequence R description binding site for residue ADP A 801 source : AC1 3) chain A residue 319 type sequence P description binding site for residue ADP A 801 source : AC1 4) chain A residue 321 type sequence L description binding site for residue ADP A 801 source : AC1 5) chain A residue 412 type sequence T description binding site for residue ADP A 801 source : AC1 6) chain A residue 413 type sequence G description binding site for residue ADP A 801 source : AC1 7) chain A residue 414 type sequence S description binding site for residue ADP A 801 source : AC1 8) chain A residue 415 type sequence G description binding site for residue ADP A 801 source : AC1 9) chain A residue 416 type sequence K description binding site for residue ADP A 801 source : AC1 10) chain A residue 417 type sequence T description binding site for residue ADP A 801 source : AC1 11) chain A residue 418 type sequence F description binding site for residue ADP A 801 source : AC1 12) chain A residue 417 type sequence T description binding site for residue MG A 802 source : AC2 13) chain A residue 410 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00283 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 559-570 type prosite sequence APLSLVDLAGSE description KINESIN_MOTOR_1 Kinesin motor domain signature. APLsLVDLAGSE source prosite : PS00411

Display surface Download Links