eF-site ID 5w9l-G
PDB Code 5w9l
Chain G

click to enlarge
Title MERS S ectodomain trimer in complex with variable domain of neutralizing antibody G4
Classification VIRAL PROTEIN
Compound Spike glycoprotein
Source (5W9L)
Sequence G:  VPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQ
EYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKIN
QALHGANLRQDDSVRNLFASVKSSQSSPIIPGFGGDFNLT
LLEPVARSAIEDLLFDKVTIADPGYMQGYDDCMQQGPASA
RDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGW
TAGLSSFAAIPFAQSIFYRLNGVGITQQVLSENQKLIANK
FNQALGAMQTGFTTTNEAFHKVQDAVNNNAQALSKLASEL
SNTFGAISASIGDIIQRLDPPEQDAQIDRLINGRLTTLNA
FVAQQLVRSESAALSAQLAKDKVNECVKAQSKRSGFCGQG
THIVSFVVNAPNGLYFMHVGYYPSNHIEVVSAYGLCDAAN
PTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSL
NTKYVAPQVTYQNISTNLPPPLL
Description (1)  Spike glycoprotein, G4 VH, G4 VL

Display surface

Download
Links