eF-site ID 5w66-J
PDB Code 5w66
Chain J

click to enlarge
Title RNA polymerase I Initial Transcribing Complex State 3
Classification TRANSCRIPTION
Compound DNA-directed RNA polymerase I subunit RPA190
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence J:  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLG
LKRYCCRRMILTHVDLIEKFLRYNPLEKR
Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex


Functional site

1) chain J
residue 7
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

2) chain J
residue 10
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

3) chain J
residue 45
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

4) chain J
residue 46
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5


Display surface

Download
Links