eF-site ID 5w66-C
PDB Code 5w66
Chain C

click to enlarge
Title RNA polymerase I Initial Transcribing Complex State 3
Classification TRANSCRIPTION
Compound DNA-directed RNA polymerase I subunit RPA190
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence C:  EWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRR
IMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVD
PDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKG
STDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADP
DILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRL
LPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKD
ARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMT
PEEIFFKSVRILKNKAEYLKNCPITQ
Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex


Functional site

1) chain C
residue 65-105
type prosite
ligand
sequence NAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLV
P
description RNA polymerases D / 30 to 40 Kd subunits signature.N-[SGAT]-[LIVMF]-R-R-x(9)-[SAR]-x(3)-[VA]-x(4)-N-x-[STA]-x(3)-[DN]-E-x-[LIV]-[GSA]-x-R-[LI]-[GAS]-[LIVM](2)-[PV].
source prosite : PS00446


Display surface

Download
Links