eF-site ID 5w66-B
PDB Code 5w66
Chain B

click to enlarge
Title RNA polymerase I Initial Transcribing Complex State 3
Classification TRANSCRIPTION
Compound DNA-directed RNA polymerase I subunit RPA190
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence B:  RTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNA
LTEGPDGGLLNLGVKDIGEKVIFDGKPLNSNSGYLGNKLS
VSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGK
LLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMS
PYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMA
IIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDG
QVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGND
VKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRV
VFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLF
MIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEK
IDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNEN
IGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF
ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDG
SPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHT
FAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGK
TPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYL
PLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNI
LSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHR
SDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVI
SYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRN
RGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGD
PICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQ
ELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDM
PFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHG
IAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSG
ATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLT
MQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSS
DYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFE
DAKKLLTEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAI
PFVLKYLDSELSAMGIRL
Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex


Functional site

1) chain B
residue 1104
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

2) chain B
residue 1106
type
ligand
sequence E
description binding site for residue ZN B 1301
source : AC3

3) chain B
residue 1107
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

4) chain B
residue 1128
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

5) chain B
residue 1131
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3


Display surface

Download
Links