eF-site ID 5w66-ABCDEFGHIJKLMNOPQRST
PDB Code 5w66
Chain A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
Title RNA polymerase I Initial Transcribing Complex State 3
Classification TRANSCRIPTION
Compound DNA-directed RNA polymerase I subunit RPA190
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence A:  MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDN
LGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYAC
KLRLLQYGLIDESYKLDEITLDISSTLLNELKSKRSEYVD
MAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSR
GKCDNCGMFSPKFRKDGFTKIFETALNEKQITNNRVKGST
YILSTEVKNILDTVFRKEQCVLQYVFHSRPNLSRKLVKAD
SFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTS
LLIRDLNDDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQND
VNAFIDSTKAQKVPIPGVKQALEKKEGLFRKHMMGKRVNY
AARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAE
LRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALA
NQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKA
SMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFP
QNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGV
WLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPT
IFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNE
YWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLH
EVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAE
GNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKR
LQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMK
KFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVP
VMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFH
CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSI
RDADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLK
KYNPSALIEHLDVESALKYSKKTLKYRKKHSPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDG
VNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
NVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADT
FCKSISKVLLSEVIDKVIVTETTAARSYVIHMRFFDNNEY
SEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKNMNKV
QRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEK
LLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTE
GVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTI
VNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQG
METSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIV
VGKLNNVGTGSFDVLAKVPNA
B:  RTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNA
LTEGPDGGLLNLGVKDIGEKVIFDGKPLNSNSGYLGNKLS
VSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGK
LLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMS
PYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMA
IIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDG
QVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGND
VKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRV
VFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLF
MIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEK
IDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNEN
IGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF
ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDG
SPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHT
FAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGK
TPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYL
PLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNI
LSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHR
SDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVI
SYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRN
RGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGD
PICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQ
ELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDM
PFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHG
IAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSG
ATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLT
MQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSS
DYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFE
DAKKLLTEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAI
PFVLKYLDSELSAMGIRL
C:  EWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRR
IMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVD
PDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKG
STDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADP
DILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRL
LPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKD
ARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMT
PEEIFFKSVRILKNKAEYLKNCPITQ
D:  TATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENTN
LSSSISQLKRIQRDFKGLP
E:  MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLE
DFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIR
KSETSGRYASYRICM
F:  KAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDL
EGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEEL
IVD
G:  NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYV
SLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGL
KILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQP
QVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWT
FVHLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
S
H:  NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDI
NVELFPVAAQDSLTVTIASSLNLRSWRPPQAGDRSLADDY
DYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLN
NLKQENAYLLIRR
I:  SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQ
FSNLKVVTTTADDAFPSSLRAKKSV
J:  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLG
LKRYCCRRMILTHVDLIEKFLRYNPLEKR
K:  EEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYV
IMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQK
GLKDLMDLCDVVESKFTEKIKSM
L:  TLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLV
QFEAR
M:  SEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSE
KDEFVLHGENERLEYEGYTDSSSQASNQYVVGLFNPEKKS
IQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNA
LGEAFGTKKAKKAIADLERNRIDSDKLTDSAIDIVDSVRT
ASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESI
IPKKELQFIRVSSILKEADKEKKLELFPYQNNSKYVAKKL
DSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERL
NSPPEILVDGILSRFTVIKPGQFGRSKDRSYFIDPQNEDK
ILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVL
GAIVKGATVAQAEAFGIPKSTAASYKIATMKVPFKL
N:  FSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNV
DISKLKSLPVDFESSTTMTIDKHDYKIMDDTDIESSLTQD
NLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSET
AKIPAIDYSKVRVPRKDVPKVEGLKLEHFATGYDAEDF
O:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXFFWDPTVANRLDSQYIQTASDLRNYRD
GTEIIAYASGKTGSVLNIAVLTRQNTLHLNRHNNVTSIEL
HSPIKSIKIPGASESIGRRSNLVGIITENSFQIFRIESVH
SRSCDVMVSSSEPLYFVEIDDLQVVDFAFNPWDLQQFAII
DIKGNWSIGRIPKNFNNNNKRKLQLIDNLHGTIFDPEELS
SWKRIEWFSHFQKILVFDRSKMIEIDFMNNWQTEVVQAKA
WSNIRDYKRIDDKNGILLTSREIIIVGASESNDPVRRISW
KHDLDPDDTTLRITVQKVKKPDHILLVAFVYSMRHKRIYM
HVFSHRKANLFQSLGCSTVLEIPGGTPTGIETILTLENFE
LVVDFLVKLRNSSEVYYYALSNTQNSIIVDHPEWASLFNN
ADEREKESIGALVSQIKLKERERISRVQNLIEHENSHDED
KYLQDLGYRLSIATNELLESWQKTKDESILSGSLSHSKLK
NLLENSDSFASIPEFSSLLDQFFQYYQDQDVTFIGFEKLL
HLFLHEDVPGLDIFYNKLLQCWVLVSPQAELLTKEIVKDI
IWSLARLEKPSLFEPIQNEISRSLSGPYQDIISSWDMDDI
P:  KLIGHEAKLLFLKSFQFILKRQIRWLITEMRFPKEFEHVA
KIIWLKILKTINDQPQEELKLQLHMTSTISILYLASTHLS
LPVYTCDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVS
ILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLL
LKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDER
HTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILS
LTESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEE
TLEFLKWMEKQFLPTQTSMEMTIDQKIARRKLYKIFPLDR
EDTHQLTFIEDLQERYAKQTPFFPPARKEAIGRLLTHIAS
QLLVDFAISKEQLKDCISRIKNACLHR
Q:  MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKSDEE
RKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKK
IEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSE
VRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPG
VQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRF
VQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSM
EPTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLL
KADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTF
LKICLDKGGFAVPSRLIENQLKSFESRLY
R:  AUGCGA
S:  CAAGTGTGAGGAAAAGTAGTTGGGTTTTTTTTGCAGTTGA
AGACA
T:  TGTCTTCAACTGCTTTCGCATGAAGTACCTCCCAACTACT
TTTCCTCACACTTG
Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex


Functional site

1) chain A
residue 102
type
ligand
sequence C
description binding site for residue ZN A 1701
source : AC1

2) chain A
residue 105
type
ligand
sequence C
description binding site for residue ZN A 1701
source : AC1

3) chain A
residue 107
type
ligand
sequence H
description binding site for residue ZN A 1701
source : AC1

4) chain A
residue 233
type
ligand
sequence C
description binding site for residue ZN A 1701
source : AC1

5) chain A
residue 236
type
ligand
sequence C
description binding site for residue ZN A 1701
source : AC1

6) chain A
residue 62
type
ligand
sequence C
description binding site for residue ZN A 1702
source : AC2

7) chain A
residue 65
type
ligand
sequence C
description binding site for residue ZN A 1702
source : AC2

8) chain A
residue 72
type
ligand
sequence C
description binding site for residue ZN A 1702
source : AC2

9) chain A
residue 74
type
ligand
sequence G
description binding site for residue ZN A 1702
source : AC2

10) chain A
residue 75
type
ligand
sequence H
description binding site for residue ZN A 1702
source : AC2

11) chain B
residue 1104
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

12) chain B
residue 1106
type
ligand
sequence E
description binding site for residue ZN B 1301
source : AC3

13) chain B
residue 1107
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

14) chain B
residue 1128
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

15) chain B
residue 1131
type
ligand
sequence C
description binding site for residue ZN B 1301
source : AC3

16) chain I
residue 10
type
ligand
sequence C
description binding site for residue ZN I 201
source : AC4

17) chain I
residue 13
type
ligand
sequence C
description binding site for residue ZN I 201
source : AC4

18) chain I
residue 30
type
ligand
sequence C
description binding site for residue ZN I 201
source : AC4

19) chain I
residue 32
type
ligand
sequence Q
description binding site for residue ZN I 201
source : AC4

20) chain I
residue 33
type
ligand
sequence C
description binding site for residue ZN I 201
source : AC4

21) chain J
residue 7
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

22) chain J
residue 10
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

23) chain J
residue 45
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

24) chain J
residue 46
type
ligand
sequence C
description binding site for residue ZN J 101
source : AC5

25) chain L
residue 31
type
ligand
sequence C
description binding site for residue ZN L 101
source : AC6

26) chain L
residue 34
type
ligand
sequence C
description binding site for residue ZN L 101
source : AC6

27) chain L
residue 48
type
ligand
sequence C
description binding site for residue ZN L 101
source : AC6

28) chain L
residue 51
type
ligand
sequence C
description binding site for residue ZN L 101
source : AC6


Display surface

Download
Links