eF-site ID 5w64-K PDB Code 5w64 Chain K click to enlarge Title RNA Polymerase I Initial Transcribing Complex State 1 Classification TRANSCRIPTION Compound DNA-directed RNA polymerase I subunit RPA190 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence K:  EEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYV IMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQK GLKDLMDLCDVVESKFTEKIKSM Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex Functional site 1) chain K residue 65-96 type prosite sequence IVEEDHTLGNALRYVIMKNPDVEFCGYSIPHP description RNA_POL_L_13KD RNA polymerases L / 13 to 16 Kd subunits signature. IveEdHTLgNaLryvImknpdVefcgYsipHP source prosite : PS01154

Display surface Download Links