eF-site ID 5w5y-K
PDB Code 5w5y
Chain K

click to enlarge
Title RNA polymerase I Initial Transcribing Complex
Classification TRANSCRIPTION
Compound DNA-directed RNA polymerase I subunit RPA190
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence K:  EEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYV
IMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQK
GLKDLMDLCDVVESKFTEKIKSM
Description (1)  DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-specific transcription initiation factor RRN6, RNA polymerase I-specific transcription initiation factor RRN7, RNA polymerase I-specific transcription initiation factor RRN11/RNA Complex


Functional site

1) chain K
residue 65-96
type prosite
sequence IVEEDHTLGNALRYVIMKNPDVEFCGYSIPHP
description RNA_POL_L_13KD RNA polymerases L / 13 to 16 Kd subunits signature. IveEdHTLgNaLryvImknpdVefcgYsipHP
source prosite : PS01154


Display surface

Download
Links