eF-site ID 5w5r-P PDB Code 5w5r Chain P click to enlarge Title Agrobacterium tumefaciens ADP-glucose pyrophosphorylase P96A mutant bound to activator pyruvate Classification TRANSFERASE Compound Glucose-1-phosphate adenylyltransferase Source (GLGC_RHIRD) Sequence P:  VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKAR IIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR PERNESFDILAATQWYEGTADAVYQNIDIIEPYAPEYMVI LAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPRMEATGF GVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVF HTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHGKAVAHR FADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLD IYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVSGDC IISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQ LSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTESGICLIT QSMIDKLDL Description Functional site 1) chain P residue 44 type sequence K description binding site for residue PYR A 503 source : AC3 2) chain P residue 309 type sequence P description binding site for residue PYR A 503 source : AC3 3) chain P residue 329 type sequence S description binding site for residue PYR A 503 source : AC3 4) chain P residue 330 type sequence G description binding site for residue PYR A 503 source : AC3 5) chain P residue 335 type sequence S description binding site for residue SO4 P 501 source : AF6 6) chain P residue 351 type sequence N description binding site for residue SO4 P 501 source : AF6 7) chain P residue 352 type sequence S description binding site for residue SO4 P 501 source : AF6 8) chain P residue 369 type sequence R description binding site for residue SO4 P 501 source : AF6 9) chain P residue 34 type sequence R description binding site for residue SO4 P 502 source : AF7 10) chain P residue 40 type sequence Y description binding site for residue SO4 P 502 source : AF7 11) chain P residue 46 type sequence R description binding site for residue SO4 P 502 source : AF7 12) chain P residue 73 type sequence S description binding site for residue SO4 P 502 source : AF7 13) chain P residue 76 type sequence R description binding site for residue SO4 P 502 source : AF7 14) chain P residue 380 type sequence H description binding site for residue SO4 P 502 source : AF7 15) chain P residue 108 type BINDING sequence Y description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 16) chain P residue 173 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 17) chain P residue 188 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 18) chain P residue 206 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links