eF-site ID 5w5r-D PDB Code 5w5r Chain D click to enlarge Title Agrobacterium tumefaciens ADP-glucose pyrophosphorylase P96A mutant bound to activator pyruvate Classification TRANSFERASE Compound Glucose-1-phosphate adenylyltransferase Source (GLGC_RHIRD) Sequence D:  VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKAR IIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR PERNESFDILAASQRTQWYEGTADAVYQNIDIIEPYAPEY MVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPRMEA TGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGI YVFHTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHGKAV AHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVP DLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVS GDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGR HAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTESGIC LITQSMIDKLDL Description Functional site 1) chain D residue 335 type sequence S description binding site for residue SO4 D 501 source : AC8 2) chain D residue 351 type sequence N description binding site for residue SO4 D 501 source : AC8 3) chain D residue 352 type sequence S description binding site for residue SO4 D 501 source : AC8 4) chain D residue 369 type sequence R description binding site for residue SO4 D 501 source : AC8 5) chain D residue 34 type sequence R description binding site for residue SO4 D 502 source : AC9 6) chain D residue 40 type sequence Y description binding site for residue SO4 D 502 source : AC9 7) chain D residue 46 type sequence R description binding site for residue SO4 D 502 source : AC9 8) chain D residue 73 type sequence S description binding site for residue SO4 D 502 source : AC9 9) chain D residue 44 type sequence K description binding site for residue PYR D 503 source : AD1 10) chain D residue 308 type sequence P description binding site for residue PYR D 503 source : AD1 11) chain D residue 329 type sequence S description binding site for residue PYR D 503 source : AD1 12) chain D residue 330 type sequence G description binding site for residue PYR D 503 source : AD1 13) chain D residue 108 type BINDING sequence Y description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 14) chain D residue 173 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 15) chain D residue 188 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 206 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links