eF-site ID 5w5r-B PDB Code 5w5r Chain B click to enlarge Title Agrobacterium tumefaciens ADP-glucose pyrophosphorylase P96A mutant bound to activator pyruvate Classification TRANSFERASE Compound Glucose-1-phosphate adenylyltransferase Source (GLGC_RHIRD) Sequence B:  VQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKAR IIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWDFFR PERNESFDILAASQRVSETQWYEGTADAVYQNIDIIEPYA PEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPR MEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALAS MGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHG KAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTD VVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVK IGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTES GICLITQSMIDKLDL Description Functional site 1) chain B residue 319 type sequence R description binding site for residue SO4 B 501 source : AC4 2) chain B residue 335 type sequence S description binding site for residue SO4 B 501 source : AC4 3) chain B residue 351 type sequence N description binding site for residue SO4 B 501 source : AC4 4) chain B residue 352 type sequence S description binding site for residue SO4 B 501 source : AC4 5) chain B residue 369 type sequence R description binding site for residue SO4 B 501 source : AC4 6) chain B residue 34 type sequence R description binding site for residue SO4 B 502 source : AC5 7) chain B residue 40 type sequence Y description binding site for residue SO4 B 502 source : AC5 8) chain B residue 46 type sequence R description binding site for residue SO4 B 502 source : AC5 9) chain B residue 73 type sequence S description binding site for residue SO4 B 502 source : AC5 10) chain B residue 76 type sequence R description binding site for residue SO4 B 502 source : AC5 11) chain B residue 380 type sequence H description binding site for residue SO4 B 502 source : AC5 12) chain B residue 309 type sequence P description binding site for residue PYR K 503 source : AE8 13) chain B residue 310 type sequence A description binding site for residue PYR K 503 source : AE8 14) chain B residue 328 type sequence V description binding site for residue PYR K 503 source : AE8 15) chain B residue 329 type sequence S description binding site for residue PYR K 503 source : AE8 16) chain B residue 330 type sequence G description binding site for residue PYR K 503 source : AE8 17) chain B residue 108 type BINDING sequence Y description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 18) chain B residue 173 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 19) chain B residue 188 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 20) chain B residue 206 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links