eF-site ID 5w5r-A PDB Code 5w5r Chain A click to enlarge Title Agrobacterium tumefaciens ADP-glucose pyrophosphorylase P96A mutant bound to activator pyruvate Classification TRANSFERASE Compound Glucose-1-phosphate adenylyltransferase Source (GLGC_RHIRD) Sequence A:  AAAVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGG KARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGWD FFRPERNESFDILAASQETQWYEGTADAVYQNIDIIEPYA PEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEVPR MEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALAS MGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPYIVEHG KAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTD VVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSS VVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVK IGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRFRRTES GICLITQSMIDKLDL Description Functional site 1) chain A residue 335 type sequence S description binding site for residue SO4 A 501 source : AC1 2) chain A residue 351 type sequence N description binding site for residue SO4 A 501 source : AC1 3) chain A residue 352 type sequence S description binding site for residue SO4 A 501 source : AC1 4) chain A residue 369 type sequence R description binding site for residue SO4 A 501 source : AC1 5) chain A residue 34 type sequence R description binding site for residue SO4 A 502 source : AC2 6) chain A residue 40 type sequence Y description binding site for residue SO4 A 502 source : AC2 7) chain A residue 46 type sequence R description binding site for residue SO4 A 502 source : AC2 8) chain A residue 73 type sequence S description binding site for residue SO4 A 502 source : AC2 9) chain A residue 44 type sequence K description binding site for residue PYR A 503 source : AC3 10) chain A residue 307 type sequence T description binding site for residue PYR A 503 source : AC3 11) chain A residue 309 type sequence P description binding site for residue PYR A 503 source : AC3 12) chain A residue 328 type sequence V description binding site for residue PYR A 503 source : AC3 13) chain A residue 329 type sequence S description binding site for residue PYR A 503 source : AC3 14) chain A residue 330 type sequence G description binding site for residue PYR A 503 source : AC3 15) chain A residue 108 type BINDING sequence Y description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 173 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 188 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 206 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00624 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 20-39 type prosite sequence AGGRGSRLKELTDRRAKPAV description ADP_GLC_PYROPHOSPH_1 ADP-glucose pyrophosphorylase signature 1. AGGrGSrLkeLTdrrAkPAV source prosite : PS00808 20) chain A residue 107-115 type prosite sequence WYEGTADAV description ADP_GLC_PYROPHOSPH_2 ADP-glucose pyrophosphorylase signature 2. WYeGTADAV source prosite : PS00809 21) chain A residue 205-215 type prosite sequence ASMGIYVFHTK description ADP_GLC_PYROPHOSPH_3 ADP-glucose pyrophosphorylase signature 3. ASMGIYVFhtK source prosite : PS00810

Display surface Download Links