eF-site ID 5vfr-F PDB Code 5vfr Chain F click to enlarge Title Nucleotide-driven Triple-state Remodeling of the AAA-ATPase Channel in the Activated Human 26S Proteasome Classification HYDROLASE Compound 26S proteasome non-ATPase regulatory subunit 1 Source (PSMD2_HUMAN) Sequence F:  RTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVN KTLPYLVSNVIELLDVKCAVIKTSTRQTYFLPVIGLVDAE KLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTE QYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGV LMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGD GAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGD REVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALL RSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEE LARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEG ILEVQAKKKANLQYYA Description (1)  Activated Human 26S Proteasome Functional site 1) chain F residue 229 type sequence P description binding site for residue AGS F 501 source : AC5 2) chain F residue 230 type sequence G description binding site for residue AGS F 501 source : AC5 3) chain F residue 233 type sequence K description binding site for residue AGS F 501 source : AC5 4) chain F residue 234 type sequence T description binding site for residue AGS F 501 source : AC5 5) chain F residue 286 type sequence D description binding site for residue AGS F 501 source : AC5 6) chain F residue 287 type sequence E description binding site for residue AGS F 501 source : AC5 7) chain F residue 331 type sequence A description binding site for residue AGS F 501 source : AC5 8) chain F residue 333 type sequence N description binding site for residue AGS F 501 source : AC5 9) chain F residue 365 type sequence I description binding site for residue AGS F 501 source : AC5 10) chain F residue 393 type sequence G description binding site for residue AGS F 501 source : AC5 11) chain F residue 394 type sequence A description binding site for residue AGS F 501 source : AC5 12) chain F residue 326-344 type prosite sequence VKVIAATNRVDILDPALLR description AAA AAA-protein family signature. VkMImATNrpdtLDpALl.R source prosite : PS00674

Display surface Download Links