eF-site ID 5umd-5
PDB Code 5umd
Chain 5

click to enlarge
Title Structure of the Plasmodium falciparum 80S ribosome bound to the antimalarial drug mefloquine
Classification RIBOSOME
Compound 28S ribosomal RNA
Source ORGANISM_SCIENTIFIC: Plasmodium falciparum 3D7;
Sequence 5:  AAKKIKTLKLINKKKRNDLRQRTLRYEEEYESERKKIIEL
KREARKNNCFYREAEKKVVFVIRLKGVNKLPPKVRSVFRL
LRLLQVHNGVFVKVNKATKEMLKIVEPYVTYGYPTLSTVR
KLLYKRGYVRVGKVRRYARKKIQDNADISKHLGKYNVHGI
EDMVYQLYTCGPVFKKVNNFLWAFKLKPPRKGFKAKRHAF
NEPRPGDWGNREAHINELINRMI
Description (1)  60S ribosomal protein L2, 60S ribosomal protein L3, 60S ribosomal protein L4, 60S ribosomal protein L11a, putative, 60S ribosomal protein L6, putative, 60S ribosomal protein L6-2, putative, 60S ribosomal protein L7-3, putative, 60S ribosomal protein L13, putative, 60S ribosomal protein L13, 60S ribosomal protein L23, putative, 60S ribosomal protein L14, putative, 60S ribosomal protein L27a, putative, Ribosomal protein L15, 60S ribosomal protein L10, putative, 60S ribosomal protein L5, putative, 60S ribosomal protein L18-2, putative, 60S ribosomal protein L19, 60S ribosomal protein L18a, 60S ribosomal protein L21, 60S ribosomal protein L17, putative, 60S ribosomal protein L22, putative, 60S ribosomal protein L23, 60S ribosomal protein L26, putative, 60S ribosomal protein L24, putative, 60S ribosomal protein L27, 60S ribosomal protein L28, 60S ribosomal protein L35, putative, 60S ribosomal protein L29, putative, 60S ribosomal protein L7, putative, 60S ribosomal protein L30e, putative, 60S ribosomal protein L31, 60S ribosomal protein L32, 60S ribosomal protein L35Ae, putative, 60S ribosomal protein L34, 60S ribosomal protein L36, Ribosomal protein L37, 60S ribosomal protein L38, 60S ribosomal protein L39, Ubiquitin-60S ribosomal protein L40, 60S ribosomal protein L41, 60S ribosomal protein L37a, 60S ribosomal protein L44/RNA Complex

Display surface

Download
Links