eF-site ID 5tis-z PDB Code 5tis Chain z click to enlarge Title Room temperature XFEL structure of the native, doubly-illuminated photosystem II complex Classification PHOTOSYNTHESIS Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus (strain BP-1); Sequence z:  MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLI FLGSGLWIALVLVVGVLNFFVV Description Functional site 1) chain z residue 19 type sequence M description binding site for residue CLA c 511 source : AQ3 2) chain z residue 20 type sequence V description binding site for residue CLA c 511 source : AQ3 3) chain z residue 51 type sequence V description binding site for residue BCR c 514 source : AQ6 4) chain z residue 16 type sequence S description binding site for residue BCR c 521 source : AR4 5) chain z residue 17 type sequence F description binding site for residue BCR c 521 source : AR4 6) chain z residue 5-25 type TRANSMEM sequence FQLALAALVILSFVMVIGVPV description Helical => ECO:0000255|HAMAP-Rule:MF_00717 source Swiss-Prot : SWS_FT_FI2 7) chain z residue 37-58 type TRANSMEM sequence KQLIFLGSGLWIALVLVVGVLN description Helical => ECO:0000255|HAMAP-Rule:MF_00717 source Swiss-Prot : SWS_FT_FI2 8) chain z residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:19219048, ECO:0000269|PubMed:20558739 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links