eF-site ID 5tdw-AB
PDB Code 5tdw
Chain A, B

click to enlarge
Title Set3 PHD finger in complex with histone H3K4me3
Classification TRANSCRIPTION
Compound SET domain-containing protein 3
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (5TDW)
Sequence A:  GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAP
DDYLCNSCDPREVDINLARKIQQERINVK
B:  ARTXQTARKST
Description (1)  SET domain-containing protein 3, histone H3K4me3


Functional site

1) chain A
residue 5
type
sequence C
description binding site for residue ZN A 101
source : AC1

2) chain A
residue 7
type
sequence C
description binding site for residue ZN A 101
source : AC1

3) chain A
residue 27
type
sequence H
description binding site for residue ZN A 101
source : AC1

4) chain A
residue 30
type
sequence C
description binding site for residue ZN A 101
source : AC1

5) chain A
residue 19
type
sequence C
description binding site for residue ZN A 102
source : AC2

6) chain A
residue 22
type
sequence C
description binding site for residue ZN A 102
source : AC2

7) chain A
residue 45
type
sequence C
description binding site for residue ZN A 102
source : AC2

8) chain A
residue 48
type
sequence C
description binding site for residue ZN A 102
source : AC2

9) chain A
residue 44
type
sequence L
description binding site for residue NA A 103
source : AC3

10) chain A
residue 45
type
sequence C
description binding site for residue NA A 103
source : AC3

11) chain A
residue 49
type
sequence D
description binding site for residue NA A 103
source : AC3

12) chain A
residue 51
type
sequence R
description binding site for residue NA A 103
source : AC3

13) chain A
residue 5-48
type prosite
sequence CICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYL
CNSC
description ZF_PHD_1 Zinc finger PHD-type signature. Ci.Cdlndddgft....................................IqCdh..Cnrw.QHaiCygikdigmapdd.................................YlCnsC
source prosite : PS01359

14) chain B
residue 2
type MOD_RES
sequence R
description Citrulline; alternate => ECO:0000269|PubMed:16567635
source Swiss-Prot : SWS_FT_FI1

15) chain B
residue 3
type MOD_RES
sequence T
description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692
source Swiss-Prot : SWS_FT_FI2

16) chain B
residue 4
type MOD_RES
sequence X
description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708
source Swiss-Prot : SWS_FT_FI3

17) chain B
residue 5
type MOD_RES
sequence Q
description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594
source Swiss-Prot : SWS_FT_FI4

18) chain B
residue 6
type MOD_RES
sequence T
description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790
source Swiss-Prot : SWS_FT_FI5

19) chain B
residue 8
type MOD_RES
sequence R
description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433
source Swiss-Prot : SWS_FT_FI6

20) chain B
residue 9
type MOD_RES
sequence K
description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708
source Swiss-Prot : SWS_FT_FI7

21) chain B
residue 10
type MOD_RES
sequence S
description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588
source Swiss-Prot : SWS_FT_FI8

22) chain B
residue 11
type MOD_RES
sequence T
description Phosphothreonine; by PKC and CHEK1 => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:18243098, ECO:0000269|PubMed:22901803
source Swiss-Prot : SWS_FT_FI9


Display surface

Download
Links