eF-site ID 5tdw-AB
PDB Code 5tdw
Chain A, B

click to enlarge
Title Set3 PHD finger in complex with histone H3K4me3
Classification TRANSCRIPTION
Compound SET domain-containing protein 3
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (5TDW)
Sequence A:  GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAP
DDYLCNSCDPREVDINLARKIQQERINVK
B:  ARTXQTARKST
Description (1)  SET domain-containing protein 3, histone H3K4me3


Functional site

1) chain A
residue 5
type
ligand
sequence C
description binding site for residue ZN A 101
source : AC1

2) chain A
residue 7
type
ligand
sequence C
description binding site for residue ZN A 101
source : AC1

3) chain A
residue 27
type
ligand
sequence H
description binding site for residue ZN A 101
source : AC1

4) chain A
residue 30
type
ligand
sequence C
description binding site for residue ZN A 101
source : AC1

5) chain A
residue 19
type
ligand
sequence C
description binding site for residue ZN A 102
source : AC2

6) chain A
residue 22
type
ligand
sequence C
description binding site for residue ZN A 102
source : AC2

7) chain A
residue 45
type
ligand
sequence C
description binding site for residue ZN A 102
source : AC2

8) chain A
residue 48
type
ligand
sequence C
description binding site for residue ZN A 102
source : AC2

9) chain A
residue 44
type
ligand
sequence L
description binding site for residue NA A 103
source : AC3

10) chain A
residue 45
type
ligand
sequence C
description binding site for residue NA A 103
source : AC3

11) chain A
residue 49
type
ligand
sequence D
description binding site for residue NA A 103
source : AC3

12) chain A
residue 51
type
ligand
sequence R
description binding site for residue NA A 103
source : AC3

13) chain A
residue 1
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence G
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

14) chain A
residue 3
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence I
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

15) chain A
residue 12
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence D
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

16) chain A
residue 14-16
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence GFT
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

17) chain A
residue 25
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence W
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

18) chain B
residue 2-3
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence RT
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4

19) chain B
residue 5-6
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence QT
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_5tdw_B_4


Display surface

Download
Links