eF-site ID 5qrv-A
PDB Code 5qrv
Chain A

click to enlarge
Title PanDDA analysis group deposition -- Crystal Structure of human Brachyury in complex with Z198194396
Classification TRANSCRIPTION
Compound T-box transcription factor T
Source (TBXT_HUMAN)
Sequence A:  ELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVS
GLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIML
NSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQN
EEITALKIKYN
Description (1)  T-box transcription factor T


Functional site

1) chain A
residue 167
type
ligand
sequence E
description binding site for residue CD A 301
source : AC1

2) chain A
residue 167
type
ligand
sequence E
description binding site for residue CD A 301
source : AC1

3) chain A
residue 186
type
ligand
sequence C
description binding site for residue CD A 301
source : AC1

4) chain A
residue 186
type
ligand
sequence C
description binding site for residue CD A 301
source : AC1

5) chain A
residue 167
type
ligand
sequence E
description binding site for residue CD A 302
source : AC2

6) chain A
residue 186
type
ligand
sequence C
description binding site for residue CD A 302
source : AC2

7) chain A
residue 122
type
ligand
sequence C
description binding site for residue CD A 303
source : AC3

8) chain A
residue 100
type
ligand
sequence H
description binding site for residue CD A 304
source : AC4

9) chain A
residue 122
type
ligand
sequence C
description binding site for residue CD A 305
source : AC5

10) chain A
residue 89
type
ligand
sequence S
description binding site for residue K2M A 306
source : AC6

11) chain A
residue 125
type
ligand
sequence I
description binding site for residue K2M A 306
source : AC6

12) chain A
residue 129
type
ligand
sequence S
description binding site for residue K2M A 306
source : AC6

13) chain A
residue 130
type
ligand
sequence P
description binding site for residue K2M A 306
source : AC6

14) chain A
residue 132
type
ligand
sequence F
description binding site for residue K2M A 306
source : AC6

15) chain A
residue 89
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence S
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

16) chain A
residue 91
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence L
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

17) chain A
residue 125
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence I
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

18) chain A
residue 129-130
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence SP
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

19) chain A
residue 173
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence V
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

20) chain A
residue 175
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence V
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306

21) chain A
residue 180
type binding
ligand K2M: 4-(furan-2-carbonyl)piperazine-1-carboxamide
sequence R
description 4-(furan-2-carbonyl)piperazine-1-carboxamide binding site
source pdb_hetatom : K2M_5qrv_A_306


Display surface

Download
Links