eF-site ID 5q0c-ABCDEFGH
PDB Code 5q0c
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[5-(4-methoxyphenyl)thiophen-2-yl]sulfonylurea and with fructose-2,6-diphosphate
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase isozyme 2
Source (F16P2_HUMAN)
Sequence A:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
B:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
C:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
D:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVKLDVLSNSLVINMLQSSYSTCV
LVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIG
TIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLV
ALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNE
GYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVH
RTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGG
LATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQK
NQ
E:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
F:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
G:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
H:  TDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSA
VRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQS
SYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNID
CLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALY
GSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGK
IYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGS
MVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYI
IEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEY
LTCVQKNQ
Description (1)  Fructose-1,6-bisphosphatase isozyme 2 (E.C.3.1.3.11)


Functional site

1) chain A
residue 21
type
ligand
sequence K
description binding site for residue 96G A 401
source : AC1

2) chain A
residue 22
type
ligand
sequence G
description binding site for residue 96G A 401
source : AC1

3) chain A
residue 23
type
ligand
sequence R
description binding site for residue 96G A 401
source : AC1

4) chain A
residue 25
type
ligand
sequence A
description binding site for residue 96G A 401
source : AC1

5) chain A
residue 27
type
ligand
sequence G
description binding site for residue 96G A 401
source : AC1

6) chain A
residue 28
type
ligand
sequence T
description binding site for residue 96G A 401
source : AC1

7) chain A
residue 29
type
ligand
sequence G
description binding site for residue 96G A 401
source : AC1

8) chain A
residue 30
type
ligand
sequence E
description binding site for residue 96G A 401
source : AC1

9) chain A
residue 31
type
ligand
sequence L
description binding site for residue 96G A 401
source : AC1

10) chain A
residue 32
type
ligand
sequence T
description binding site for residue 96G A 401
source : AC1

11) chain A
residue 178
type
ligand
sequence T
description binding site for residue 96G A 401
source : AC1

12) chain A
residue 180
type
ligand
sequence Q
description binding site for residue 96G A 401
source : AC1

13) chain C
residue 28
type
ligand
sequence T
description binding site for residue 96G A 401
source : AC1

14) chain C
residue 29
type
ligand
sequence G
description binding site for residue 96G A 401
source : AC1

15) chain A
residue 122
type
ligand
sequence D
description binding site for residue FDP A 402
source : AC2

16) chain A
residue 123
type
ligand
sequence G
description binding site for residue FDP A 402
source : AC2

17) chain A
residue 124
type
ligand
sequence S
description binding site for residue FDP A 402
source : AC2

18) chain A
residue 125
type
ligand
sequence S
description binding site for residue FDP A 402
source : AC2

19) chain A
residue 213
type
ligand
sequence N
description binding site for residue FDP A 402
source : AC2

20) chain A
residue 216
type
ligand
sequence Y
description binding site for residue FDP A 402
source : AC2

21) chain A
residue 245
type
ligand
sequence Y
description binding site for residue FDP A 402
source : AC2

22) chain A
residue 247
type
ligand
sequence G
description binding site for residue FDP A 402
source : AC2

23) chain A
residue 248
type
ligand
sequence S
description binding site for residue FDP A 402
source : AC2

24) chain A
residue 249
type
ligand
sequence M
description binding site for residue FDP A 402
source : AC2

25) chain A
residue 265
type
ligand
sequence Y
description binding site for residue FDP A 402
source : AC2

26) chain A
residue 275
type
ligand
sequence K
description binding site for residue FDP A 402
source : AC2

27) chain A
residue 281
type
ligand
sequence E
description binding site for residue FDP A 402
source : AC2

28) chain B
residue 244
type
ligand
sequence R
description binding site for residue FDP A 402
source : AC2

29) chain B
residue 19
type
ligand
sequence M
description binding site for residue 96G B 401
source : AC3

30) chain B
residue 21
type
ligand
sequence K
description binding site for residue 96G B 401
source : AC3

31) chain B
residue 22
type
ligand
sequence G
description binding site for residue 96G B 401
source : AC3

32) chain B
residue 23
type
ligand
sequence R
description binding site for residue 96G B 401
source : AC3

33) chain B
residue 25
type
ligand
sequence A
description binding site for residue 96G B 401
source : AC3

34) chain B
residue 27
type
ligand
sequence G
description binding site for residue 96G B 401
source : AC3

35) chain B
residue 28
type
ligand
sequence T
description binding site for residue 96G B 401
source : AC3

36) chain B
residue 29
type
ligand
sequence G
description binding site for residue 96G B 401
source : AC3

37) chain B
residue 30
type
ligand
sequence E
description binding site for residue 96G B 401
source : AC3

38) chain B
residue 31
type
ligand
sequence L
description binding site for residue 96G B 401
source : AC3

39) chain B
residue 32
type
ligand
sequence T
description binding site for residue 96G B 401
source : AC3

40) chain B
residue 178
type
ligand
sequence T
description binding site for residue 96G B 401
source : AC3

41) chain B
residue 180
type
ligand
sequence Q
description binding site for residue 96G B 401
source : AC3

42) chain D
residue 29
type
ligand
sequence G
description binding site for residue 96G B 401
source : AC3

43) chain A
residue 244
type
ligand
sequence R
description binding site for residue FDP B 402
source : AC4

44) chain B
residue 122
type
ligand
sequence D
description binding site for residue FDP B 402
source : AC4

45) chain B
residue 123
type
ligand
sequence G
description binding site for residue FDP B 402
source : AC4

46) chain B
residue 124
type
ligand
sequence S
description binding site for residue FDP B 402
source : AC4

47) chain B
residue 125
type
ligand
sequence S
description binding site for residue FDP B 402
source : AC4

48) chain B
residue 213
type
ligand
sequence N
description binding site for residue FDP B 402
source : AC4

49) chain B
residue 216
type
ligand
sequence Y
description binding site for residue FDP B 402
source : AC4

50) chain B
residue 245
type
ligand
sequence Y
description binding site for residue FDP B 402
source : AC4

51) chain B
residue 247
type
ligand
sequence G
description binding site for residue FDP B 402
source : AC4

52) chain B
residue 248
type
ligand
sequence S
description binding site for residue FDP B 402
source : AC4

53) chain B
residue 249
type
ligand
sequence M
description binding site for residue FDP B 402
source : AC4

54) chain B
residue 265
type
ligand
sequence Y
description binding site for residue FDP B 402
source : AC4

55) chain B
residue 275
type
ligand
sequence K
description binding site for residue FDP B 402
source : AC4

56) chain B
residue 281
type
ligand
sequence E
description binding site for residue FDP B 402
source : AC4

57) chain C
residue 21
type
ligand
sequence K
description binding site for residue 96G C 401
source : AC5

58) chain C
residue 22
type
ligand
sequence G
description binding site for residue 96G C 401
source : AC5

59) chain C
residue 23
type
ligand
sequence R
description binding site for residue 96G C 401
source : AC5

60) chain C
residue 25
type
ligand
sequence A
description binding site for residue 96G C 401
source : AC5

61) chain C
residue 27
type
ligand
sequence G
description binding site for residue 96G C 401
source : AC5

62) chain C
residue 28
type
ligand
sequence T
description binding site for residue 96G C 401
source : AC5

63) chain C
residue 29
type
ligand
sequence G
description binding site for residue 96G C 401
source : AC5

64) chain C
residue 30
type
ligand
sequence E
description binding site for residue 96G C 401
source : AC5

65) chain C
residue 31
type
ligand
sequence L
description binding site for residue 96G C 401
source : AC5

66) chain C
residue 32
type
ligand
sequence T
description binding site for residue 96G C 401
source : AC5

67) chain C
residue 178
type
ligand
sequence T
description binding site for residue 96G C 401
source : AC5

68) chain C
residue 180
type
ligand
sequence Q
description binding site for residue 96G C 401
source : AC5

69) chain C
residue 122
type
ligand
sequence D
description binding site for residue FDP C 402
source : AC6

70) chain C
residue 123
type
ligand
sequence G
description binding site for residue FDP C 402
source : AC6

71) chain C
residue 124
type
ligand
sequence S
description binding site for residue FDP C 402
source : AC6

72) chain C
residue 125
type
ligand
sequence S
description binding site for residue FDP C 402
source : AC6

73) chain C
residue 213
type
ligand
sequence N
description binding site for residue FDP C 402
source : AC6

74) chain C
residue 216
type
ligand
sequence Y
description binding site for residue FDP C 402
source : AC6

75) chain C
residue 245
type
ligand
sequence Y
description binding site for residue FDP C 402
source : AC6

76) chain C
residue 247
type
ligand
sequence G
description binding site for residue FDP C 402
source : AC6

77) chain C
residue 248
type
ligand
sequence S
description binding site for residue FDP C 402
source : AC6

78) chain C
residue 249
type
ligand
sequence M
description binding site for residue FDP C 402
source : AC6

79) chain C
residue 265
type
ligand
sequence Y
description binding site for residue FDP C 402
source : AC6

80) chain C
residue 275
type
ligand
sequence K
description binding site for residue FDP C 402
source : AC6

81) chain C
residue 281
type
ligand
sequence E
description binding site for residue FDP C 402
source : AC6

82) chain D
residue 244
type
ligand
sequence R
description binding site for residue FDP C 402
source : AC6

83) chain B
residue 29
type
ligand
sequence G
description binding site for residue 96G D 401
source : AC7

84) chain D
residue 21
type
ligand
sequence K
description binding site for residue 96G D 401
source : AC7

85) chain D
residue 22
type
ligand
sequence G
description binding site for residue 96G D 401
source : AC7

86) chain D
residue 23
type
ligand
sequence R
description binding site for residue 96G D 401
source : AC7

87) chain D
residue 25
type
ligand
sequence A
description binding site for residue 96G D 401
source : AC7

88) chain D
residue 27
type
ligand
sequence G
description binding site for residue 96G D 401
source : AC7

89) chain D
residue 28
type
ligand
sequence T
description binding site for residue 96G D 401
source : AC7

90) chain D
residue 29
type
ligand
sequence G
description binding site for residue 96G D 401
source : AC7

91) chain D
residue 30
type
ligand
sequence E
description binding site for residue 96G D 401
source : AC7

92) chain D
residue 31
type
ligand
sequence L
description binding site for residue 96G D 401
source : AC7

93) chain D
residue 32
type
ligand
sequence T
description binding site for residue 96G D 401
source : AC7

94) chain D
residue 178
type
ligand
sequence T
description binding site for residue 96G D 401
source : AC7

95) chain D
residue 180
type
ligand
sequence Q
description binding site for residue 96G D 401
source : AC7

96) chain C
residue 244
type
ligand
sequence R
description binding site for residue FDP D 402
source : AC8

97) chain D
residue 122
type
ligand
sequence D
description binding site for residue FDP D 402
source : AC8

98) chain D
residue 123
type
ligand
sequence G
description binding site for residue FDP D 402
source : AC8

99) chain D
residue 124
type
ligand
sequence S
description binding site for residue FDP D 402
source : AC8

100) chain D
residue 125
type
ligand
sequence S
description binding site for residue FDP D 402
source : AC8

101) chain D
residue 213
type
ligand
sequence N
description binding site for residue FDP D 402
source : AC8

102) chain D
residue 216
type
ligand
sequence Y
description binding site for residue FDP D 402
source : AC8

103) chain D
residue 245
type
ligand
sequence Y
description binding site for residue FDP D 402
source : AC8

104) chain D
residue 247
type
ligand
sequence G
description binding site for residue FDP D 402
source : AC8

105) chain D
residue 248
type
ligand
sequence S
description binding site for residue FDP D 402
source : AC8

106) chain D
residue 249
type
ligand
sequence M
description binding site for residue FDP D 402
source : AC8

107) chain D
residue 265
type
ligand
sequence Y
description binding site for residue FDP D 402
source : AC8

108) chain D
residue 275
type
ligand
sequence K
description binding site for residue FDP D 402
source : AC8

109) chain D
residue 281
type
ligand
sequence E
description binding site for residue FDP D 402
source : AC8

110) chain E
residue 19
type
ligand
sequence M
description binding site for residue 96G E 401
source : AC9

111) chain E
residue 21
type
ligand
sequence K
description binding site for residue 96G E 401
source : AC9

112) chain E
residue 22
type
ligand
sequence G
description binding site for residue 96G E 401
source : AC9

113) chain E
residue 23
type
ligand
sequence R
description binding site for residue 96G E 401
source : AC9

114) chain E
residue 25
type
ligand
sequence A
description binding site for residue 96G E 401
source : AC9

115) chain E
residue 27
type
ligand
sequence G
description binding site for residue 96G E 401
source : AC9

116) chain E
residue 29
type
ligand
sequence G
description binding site for residue 96G E 401
source : AC9

117) chain E
residue 30
type
ligand
sequence E
description binding site for residue 96G E 401
source : AC9

118) chain E
residue 31
type
ligand
sequence L
description binding site for residue 96G E 401
source : AC9

119) chain E
residue 32
type
ligand
sequence T
description binding site for residue 96G E 401
source : AC9

120) chain E
residue 178
type
ligand
sequence T
description binding site for residue 96G E 401
source : AC9

121) chain E
residue 180
type
ligand
sequence Q
description binding site for residue 96G E 401
source : AC9

122) chain E
residue 122
type
ligand
sequence D
description binding site for residue FDP E 402
source : AD1

123) chain E
residue 123
type
ligand
sequence G
description binding site for residue FDP E 402
source : AD1

124) chain E
residue 124
type
ligand
sequence S
description binding site for residue FDP E 402
source : AD1

125) chain E
residue 125
type
ligand
sequence S
description binding site for residue FDP E 402
source : AD1

126) chain E
residue 213
type
ligand
sequence N
description binding site for residue FDP E 402
source : AD1

127) chain E
residue 216
type
ligand
sequence Y
description binding site for residue FDP E 402
source : AD1

128) chain E
residue 245
type
ligand
sequence Y
description binding site for residue FDP E 402
source : AD1

129) chain E
residue 247
type
ligand
sequence G
description binding site for residue FDP E 402
source : AD1

130) chain E
residue 248
type
ligand
sequence S
description binding site for residue FDP E 402
source : AD1

131) chain E
residue 249
type
ligand
sequence M
description binding site for residue FDP E 402
source : AD1

132) chain E
residue 265
type
ligand
sequence Y
description binding site for residue FDP E 402
source : AD1

133) chain E
residue 275
type
ligand
sequence K
description binding site for residue FDP E 402
source : AD1

134) chain E
residue 281
type
ligand
sequence E
description binding site for residue FDP E 402
source : AD1

135) chain F
residue 244
type
ligand
sequence R
description binding site for residue FDP E 402
source : AD1

136) chain F
residue 19
type
ligand
sequence M
description binding site for residue 96G F 401
source : AD2

137) chain F
residue 21
type
ligand
sequence K
description binding site for residue 96G F 401
source : AD2

138) chain F
residue 22
type
ligand
sequence G
description binding site for residue 96G F 401
source : AD2

139) chain F
residue 23
type
ligand
sequence R
description binding site for residue 96G F 401
source : AD2

140) chain F
residue 25
type
ligand
sequence A
description binding site for residue 96G F 401
source : AD2

141) chain F
residue 27
type
ligand
sequence G
description binding site for residue 96G F 401
source : AD2

142) chain F
residue 28
type
ligand
sequence T
description binding site for residue 96G F 401
source : AD2

143) chain F
residue 29
type
ligand
sequence G
description binding site for residue 96G F 401
source : AD2

144) chain F
residue 30
type
ligand
sequence E
description binding site for residue 96G F 401
source : AD2

145) chain F
residue 31
type
ligand
sequence L
description binding site for residue 96G F 401
source : AD2

146) chain F
residue 32
type
ligand
sequence T
description binding site for residue 96G F 401
source : AD2

147) chain F
residue 178
type
ligand
sequence T
description binding site for residue 96G F 401
source : AD2

148) chain F
residue 180
type
ligand
sequence Q
description binding site for residue 96G F 401
source : AD2

149) chain E
residue 244
type
ligand
sequence R
description binding site for residue FDP F 402
source : AD3

150) chain F
residue 122
type
ligand
sequence D
description binding site for residue FDP F 402
source : AD3

151) chain F
residue 123
type
ligand
sequence G
description binding site for residue FDP F 402
source : AD3

152) chain F
residue 124
type
ligand
sequence S
description binding site for residue FDP F 402
source : AD3

153) chain F
residue 125
type
ligand
sequence S
description binding site for residue FDP F 402
source : AD3

154) chain F
residue 213
type
ligand
sequence N
description binding site for residue FDP F 402
source : AD3

155) chain F
residue 216
type
ligand
sequence Y
description binding site for residue FDP F 402
source : AD3

156) chain F
residue 245
type
ligand
sequence Y
description binding site for residue FDP F 402
source : AD3

157) chain F
residue 247
type
ligand
sequence G
description binding site for residue FDP F 402
source : AD3

158) chain F
residue 248
type
ligand
sequence S
description binding site for residue FDP F 402
source : AD3

159) chain F
residue 249
type
ligand
sequence M
description binding site for residue FDP F 402
source : AD3

160) chain F
residue 265
type
ligand
sequence Y
description binding site for residue FDP F 402
source : AD3

161) chain F
residue 275
type
ligand
sequence K
description binding site for residue FDP F 402
source : AD3

162) chain F
residue 281
type
ligand
sequence E
description binding site for residue FDP F 402
source : AD3

163) chain G
residue 21
type
ligand
sequence K
description binding site for residue 96G G 401
source : AD4

164) chain G
residue 22
type
ligand
sequence G
description binding site for residue 96G G 401
source : AD4

165) chain G
residue 23
type
ligand
sequence R
description binding site for residue 96G G 401
source : AD4

166) chain G
residue 25
type
ligand
sequence A
description binding site for residue 96G G 401
source : AD4

167) chain G
residue 27
type
ligand
sequence G
description binding site for residue 96G G 401
source : AD4

168) chain G
residue 29
type
ligand
sequence G
description binding site for residue 96G G 401
source : AD4

169) chain G
residue 30
type
ligand
sequence E
description binding site for residue 96G G 401
source : AD4

170) chain G
residue 31
type
ligand
sequence L
description binding site for residue 96G G 401
source : AD4

171) chain G
residue 32
type
ligand
sequence T
description binding site for residue 96G G 401
source : AD4

172) chain G
residue 180
type
ligand
sequence Q
description binding site for residue 96G G 401
source : AD4

173) chain G
residue 122
type
ligand
sequence D
description binding site for residue FDP G 402
source : AD5

174) chain G
residue 123
type
ligand
sequence G
description binding site for residue FDP G 402
source : AD5

175) chain G
residue 124
type
ligand
sequence S
description binding site for residue FDP G 402
source : AD5

176) chain G
residue 125
type
ligand
sequence S
description binding site for residue FDP G 402
source : AD5

177) chain G
residue 213
type
ligand
sequence N
description binding site for residue FDP G 402
source : AD5

178) chain G
residue 216
type
ligand
sequence Y
description binding site for residue FDP G 402
source : AD5

179) chain G
residue 245
type
ligand
sequence Y
description binding site for residue FDP G 402
source : AD5

180) chain G
residue 247
type
ligand
sequence G
description binding site for residue FDP G 402
source : AD5

181) chain G
residue 248
type
ligand
sequence S
description binding site for residue FDP G 402
source : AD5

182) chain G
residue 249
type
ligand
sequence M
description binding site for residue FDP G 402
source : AD5

183) chain G
residue 265
type
ligand
sequence Y
description binding site for residue FDP G 402
source : AD5

184) chain G
residue 275
type
ligand
sequence K
description binding site for residue FDP G 402
source : AD5

185) chain G
residue 281
type
ligand
sequence E
description binding site for residue FDP G 402
source : AD5

186) chain H
residue 244
type
ligand
sequence R
description binding site for residue FDP G 402
source : AD5

187) chain H
residue 19
type
ligand
sequence M
description binding site for residue 96G H 401
source : AD6

188) chain H
residue 22
type
ligand
sequence G
description binding site for residue 96G H 401
source : AD6

189) chain H
residue 23
type
ligand
sequence R
description binding site for residue 96G H 401
source : AD6

190) chain H
residue 25
type
ligand
sequence A
description binding site for residue 96G H 401
source : AD6

191) chain H
residue 27
type
ligand
sequence G
description binding site for residue 96G H 401
source : AD6

192) chain H
residue 29
type
ligand
sequence G
description binding site for residue 96G H 401
source : AD6

193) chain H
residue 30
type
ligand
sequence E
description binding site for residue 96G H 401
source : AD6

194) chain H
residue 31
type
ligand
sequence L
description binding site for residue 96G H 401
source : AD6

195) chain H
residue 32
type
ligand
sequence T
description binding site for residue 96G H 401
source : AD6

196) chain H
residue 178
type
ligand
sequence T
description binding site for residue 96G H 401
source : AD6

197) chain H
residue 180
type
ligand
sequence Q
description binding site for residue 96G H 401
source : AD6

198) chain G
residue 244
type
ligand
sequence R
description binding site for residue FDP H 402
source : AD7

199) chain H
residue 122
type
ligand
sequence D
description binding site for residue FDP H 402
source : AD7

200) chain H
residue 123
type
ligand
sequence G
description binding site for residue FDP H 402
source : AD7

201) chain H
residue 124
type
ligand
sequence S
description binding site for residue FDP H 402
source : AD7

202) chain H
residue 125
type
ligand
sequence S
description binding site for residue FDP H 402
source : AD7

203) chain H
residue 213
type
ligand
sequence N
description binding site for residue FDP H 402
source : AD7

204) chain H
residue 216
type
ligand
sequence Y
description binding site for residue FDP H 402
source : AD7

205) chain H
residue 245
type
ligand
sequence Y
description binding site for residue FDP H 402
source : AD7

206) chain H
residue 247
type
ligand
sequence G
description binding site for residue FDP H 402
source : AD7

207) chain H
residue 248
type
ligand
sequence S
description binding site for residue FDP H 402
source : AD7

208) chain H
residue 249
type
ligand
sequence M
description binding site for residue FDP H 402
source : AD7

209) chain H
residue 265
type
ligand
sequence Y
description binding site for residue FDP H 402
source : AD7

210) chain H
residue 275
type
ligand
sequence K
description binding site for residue FDP H 402
source : AD7

211) chain H
residue 281
type
ligand
sequence E
description binding site for residue FDP H 402
source : AD7

212) chain A
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

213) chain A
residue 21-23
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

214) chain A
residue 25-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence AKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

215) chain A
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

216) chain A
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

217) chain A
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

218) chain C
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

219) chain C
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_A_401

220) chain A
residue 27-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence GTG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

221) chain A
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

222) chain C
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

223) chain C
residue 21-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGRQAKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

224) chain C
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

225) chain C
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

226) chain C
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_C_401

227) chain A
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

228) chain A
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

229) chain A
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

230) chain A
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

231) chain A
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

232) chain A
residue 247-250
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSMV
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

233) chain A
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

234) chain A
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

235) chain A
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

236) chain A
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

237) chain B
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_A_402

238) chain A
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

239) chain B
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

240) chain B
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

241) chain B
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

242) chain B
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

243) chain B
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

244) chain B
residue 247-250
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSMV
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

245) chain B
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

246) chain B
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

247) chain B
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

248) chain B
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_B_402

249) chain B
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

250) chain B
residue 21-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGRQAKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

251) chain B
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

252) chain B
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

253) chain B
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

254) chain D
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

255) chain D
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_B_401

256) chain B
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

257) chain B
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

258) chain D
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

259) chain D
residue 21-23
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

260) chain D
residue 25
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

261) chain D
residue 27-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

262) chain D
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

263) chain D
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

264) chain D
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_D_401

265) chain C
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

266) chain C
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

267) chain C
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

268) chain C
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

269) chain C
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

270) chain C
residue 247-250
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSMV
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

271) chain C
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

272) chain C
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

273) chain C
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

274) chain C
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

275) chain D
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_C_402

276) chain C
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

277) chain D
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

278) chain D
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

279) chain D
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

280) chain D
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

281) chain D
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

282) chain D
residue 247-249
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSM
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

283) chain D
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

284) chain D
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

285) chain D
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

286) chain D
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_D_402

287) chain E
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

288) chain E
residue 21-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGRQAKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

289) chain E
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

290) chain E
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

291) chain E
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

292) chain G
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

293) chain G
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_E_401

294) chain E
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

295) chain E
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

296) chain G
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

297) chain G
residue 21-23
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

298) chain G
residue 25-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence AKGTGELTQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

299) chain G
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

300) chain G
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

301) chain G
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_G_401

302) chain E
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

303) chain E
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

304) chain E
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

305) chain E
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

306) chain E
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

307) chain E
residue 247-250
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSMV
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

308) chain E
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

309) chain E
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

310) chain E
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

311) chain E
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

312) chain F
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_E_402

313) chain E
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

314) chain F
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

315) chain F
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

316) chain F
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

317) chain F
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

318) chain F
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

319) chain F
residue 247-249
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSM
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

320) chain F
residue 252
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

321) chain F
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

322) chain F
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

323) chain F
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

324) chain F
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_F_402

325) chain F
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

326) chain F
residue 21-23
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

327) chain F
residue 25-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence AKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

328) chain F
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

329) chain F
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

330) chain F
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

331) chain H
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

332) chain H
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_F_401

333) chain F
residue 28-29
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

334) chain F
residue 32-33
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

335) chain H
residue 18-19
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

336) chain H
residue 21-32
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence KGRQAKGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

337) chain H
residue 114
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

338) chain H
residue 178
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence T
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

339) chain H
residue 180
type binding
ligand 96G: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide
sequence Q
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-5-(4-methoxyphenyl)thiophene-2-sulfonamide binding site
source pdb_hetatom : 96G_5q0c_H_401

340) chain G
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

341) chain G
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

342) chain G
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

343) chain G
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

344) chain G
residue 247-250
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSMV
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

345) chain G
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

346) chain G
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

347) chain G
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

348) chain G
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

349) chain H
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_G_402

350) chain G
residue 244
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence R
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

351) chain H
residue 119
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence D
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

352) chain H
residue 122-126
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence DGSSN
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

353) chain H
residue 213
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence N
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

354) chain H
residue 216
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

355) chain H
residue 245
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

356) chain H
residue 247-249
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence GSM
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

357) chain H
residue 263
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence F
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

358) chain H
residue 265
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence Y
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

359) chain H
residue 275-276
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence KL
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402

360) chain H
residue 281
type binding
ligand FDP: FRUCTOSE-2,6-DIPHOSPHATE
sequence E
description FRUCTOSE-2,6-DIPHOSPHATE binding site
source pdb_hetatom : FDP_5q0c_H_402


Display surface

Download
Links