eF-site ID 5q0b-C
PDB Code 5q0b
Chain C

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-3-methyl-1,2-thiazol-5-yl)-3-(3-methylphenyl)sulfonylurea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain C
residue 27
type
ligand
sequence T
description binding site for residue 96J A 401
source : AC1

2) chain C
residue 17
type
ligand
sequence V
description binding site for residue 96J C 401
source : AC3

3) chain C
residue 18
type
ligand
sequence M
description binding site for residue 96J C 401
source : AC3

4) chain C
residue 21
type
ligand
sequence G
description binding site for residue 96J C 401
source : AC3

5) chain C
residue 22
type
ligand
sequence R
description binding site for residue 96J C 401
source : AC3

6) chain C
residue 24
type
ligand
sequence A
description binding site for residue 96J C 401
source : AC3

7) chain C
residue 26
type
ligand
sequence G
description binding site for residue 96J C 401
source : AC3

8) chain C
residue 27
type
ligand
sequence T
description binding site for residue 96J C 401
source : AC3

9) chain C
residue 28
type
ligand
sequence G
description binding site for residue 96J C 401
source : AC3

10) chain C
residue 29
type
ligand
sequence E
description binding site for residue 96J C 401
source : AC3

11) chain C
residue 30
type
ligand
sequence L
description binding site for residue 96J C 401
source : AC3

12) chain C
residue 31
type
ligand
sequence T
description binding site for residue 96J C 401
source : AC3

13) chain C
residue 18
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence M
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_A_401

14) chain C
residue 26-28
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence GTG
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_A_401

15) chain C
residue 17-18
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence VM
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401

16) chain C
residue 20-22
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence EGR
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401

17) chain C
residue 24-31
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence ARGTGELT
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401

18) chain C
residue 34
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence L
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401

19) chain C
residue 113
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence Y
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401

20) chain C
residue 177
type binding
ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide
sequence M
description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site
source pdb_hetatom : 96J_5q0b_C_401


Display surface

Download
Links