eF-site ID 5q0b-A PDB Code 5q0b Chain A click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-3-methyl-1,2-thiazol-5-yl)-3-(3-methylphenyl)sulfonylurea Classification HYDROLASE/HYDROLASE INHIBITOR Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSS FATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDC LVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYG SATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKI YSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSM VADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVM EKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFL KVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 96J A 401 source : AC1 2) chain A residue 18 type ligand sequence M description binding site for residue 96J A 401 source : AC1 3) chain A residue 21 type ligand sequence G description binding site for residue 96J A 401 source : AC1 4) chain A residue 22 type ligand sequence R description binding site for residue 96J A 401 source : AC1 5) chain A residue 24 type ligand sequence A description binding site for residue 96J A 401 source : AC1 6) chain A residue 26 type ligand sequence G description binding site for residue 96J A 401 source : AC1 7) chain A residue 27 type ligand sequence T description binding site for residue 96J A 401 source : AC1 8) chain A residue 28 type ligand sequence G description binding site for residue 96J A 401 source : AC1 9) chain A residue 29 type ligand sequence E description binding site for residue 96J A 401 source : AC1 10) chain A residue 30 type ligand sequence L description binding site for residue 96J A 401 source : AC1 11) chain A residue 31 type ligand sequence T description binding site for residue 96J A 401 source : AC1 12) chain A residue 27 type ligand sequence T description binding site for residue 96J C 401 source : AC3 13) chain A residue 17-18 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence VM description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 14) chain A residue 20-22 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence EGR description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 15) chain A residue 24-31 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence ARGTGELT description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 16) chain A residue 34 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence L description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 17) chain A residue 112-113 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence KY description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 18) chain A residue 177 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence M description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_A_401 19) chain A residue 18 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence M description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_C_401 20) chain A residue 26-28 type binding ligand 96J: N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide sequence GTG description N-[(4-bromo-3-methyl-1,2-thiazol-5-yl)carbamoyl]-3-methylbenzene-1-sulfonamide binding site source pdb_hetatom : 96J_5q0b_C_401

Display surface Download Links