eF-site ID 5q0a-C PDB Code 5q0a Chain C click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-cyanopyrazin-2-yl)-3-[3-(difluoromethoxy)phenyl]sulfonylurea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain C residue 26 type ligand sequence G description binding site for residue 96D A 401 source : AC1 2) chain C residue 27 type ligand sequence T description binding site for residue 96D A 401 source : AC1 3) chain C residue 28 type ligand sequence G description binding site for residue 96D A 401 source : AC1 4) chain C residue 17 type ligand sequence V description binding site for residue 96D C 401 source : AC3 5) chain C residue 20 type ligand sequence E description binding site for residue 96D C 401 source : AC3 6) chain C residue 21 type ligand sequence G description binding site for residue 96D C 401 source : AC3 7) chain C residue 22 type ligand sequence R description binding site for residue 96D C 401 source : AC3 8) chain C residue 24 type ligand sequence A description binding site for residue 96D C 401 source : AC3 9) chain C residue 26 type ligand sequence G description binding site for residue 96D C 401 source : AC3 10) chain C residue 27 type ligand sequence T description binding site for residue 96D C 401 source : AC3 11) chain C residue 28 type ligand sequence G description binding site for residue 96D C 401 source : AC3 12) chain C residue 29 type ligand sequence E description binding site for residue 96D C 401 source : AC3 13) chain C residue 30 type ligand sequence L description binding site for residue 96D C 401 source : AC3 14) chain C residue 31 type ligand sequence T description binding site for residue 96D C 401 source : AC3 15) chain C residue 34 type ligand sequence L description binding site for residue 96D C 401 source : AC3 16) chain C residue 18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 17) chain C residue 26-28 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence GTG description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 18) chain C residue 16-18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence FVM description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 19) chain C residue 20-22 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence EGR description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 20) chain C residue 24-31 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence ARGTGELT description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 21) chain C residue 34 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence L description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 22) chain C residue 113 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence Y description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 23) chain C residue 177 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401

Display surface Download Links