eF-site ID 5q0a-ABCD PDB Code 5q0a Chain A, B, C, D click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(5-cyanopyrazin-2-yl)-3-[3-(difluoromethoxy)phenyl]sulfonylurea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKKLDVLSNDLVMNMLKSSFATCVLVSE EDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFG IYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAM DCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAK DFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV YGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATT GKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain A residue 17 type ligand sequence V description binding site for residue 96D A 401 source : AC1 2) chain A residue 18 type ligand sequence M description binding site for residue 96D A 401 source : AC1 3) chain A residue 20 type ligand sequence E description binding site for residue 96D A 401 source : AC1 4) chain A residue 21 type ligand sequence G description binding site for residue 96D A 401 source : AC1 5) chain A residue 22 type ligand sequence R description binding site for residue 96D A 401 source : AC1 6) chain A residue 24 type ligand sequence A description binding site for residue 96D A 401 source : AC1 7) chain A residue 25 type ligand sequence R description binding site for residue 96D A 401 source : AC1 8) chain A residue 26 type ligand sequence G description binding site for residue 96D A 401 source : AC1 9) chain A residue 27 type ligand sequence T description binding site for residue 96D A 401 source : AC1 10) chain A residue 28 type ligand sequence G description binding site for residue 96D A 401 source : AC1 11) chain A residue 29 type ligand sequence E description binding site for residue 96D A 401 source : AC1 12) chain A residue 30 type ligand sequence L description binding site for residue 96D A 401 source : AC1 13) chain A residue 31 type ligand sequence T description binding site for residue 96D A 401 source : AC1 14) chain A residue 34 type ligand sequence L description binding site for residue 96D A 401 source : AC1 15) chain A residue 177 type ligand sequence M description binding site for residue 96D A 401 source : AC1 16) chain C residue 26 type ligand sequence G description binding site for residue 96D A 401 source : AC1 17) chain C residue 27 type ligand sequence T description binding site for residue 96D A 401 source : AC1 18) chain C residue 28 type ligand sequence G description binding site for residue 96D A 401 source : AC1 19) chain B residue 17 type ligand sequence V description binding site for residue 96D B 401 source : AC2 20) chain B residue 18 type ligand sequence M description binding site for residue 96D B 401 source : AC2 21) chain B residue 20 type ligand sequence E description binding site for residue 96D B 401 source : AC2 22) chain B residue 21 type ligand sequence G description binding site for residue 96D B 401 source : AC2 23) chain B residue 22 type ligand sequence R description binding site for residue 96D B 401 source : AC2 24) chain B residue 24 type ligand sequence A description binding site for residue 96D B 401 source : AC2 25) chain B residue 26 type ligand sequence G description binding site for residue 96D B 401 source : AC2 26) chain B residue 27 type ligand sequence T description binding site for residue 96D B 401 source : AC2 27) chain B residue 28 type ligand sequence G description binding site for residue 96D B 401 source : AC2 28) chain B residue 29 type ligand sequence E description binding site for residue 96D B 401 source : AC2 29) chain B residue 30 type ligand sequence L description binding site for residue 96D B 401 source : AC2 30) chain B residue 31 type ligand sequence T description binding site for residue 96D B 401 source : AC2 31) chain B residue 34 type ligand sequence L description binding site for residue 96D B 401 source : AC2 32) chain D residue 26 type ligand sequence G description binding site for residue 96D B 401 source : AC2 33) chain D residue 27 type ligand sequence T description binding site for residue 96D B 401 source : AC2 34) chain D residue 28 type ligand sequence G description binding site for residue 96D B 401 source : AC2 35) chain A residue 26 type ligand sequence G description binding site for residue 96D C 401 source : AC3 36) chain A residue 27 type ligand sequence T description binding site for residue 96D C 401 source : AC3 37) chain A residue 28 type ligand sequence G description binding site for residue 96D C 401 source : AC3 38) chain C residue 17 type ligand sequence V description binding site for residue 96D C 401 source : AC3 39) chain C residue 20 type ligand sequence E description binding site for residue 96D C 401 source : AC3 40) chain C residue 21 type ligand sequence G description binding site for residue 96D C 401 source : AC3 41) chain C residue 22 type ligand sequence R description binding site for residue 96D C 401 source : AC3 42) chain C residue 24 type ligand sequence A description binding site for residue 96D C 401 source : AC3 43) chain C residue 26 type ligand sequence G description binding site for residue 96D C 401 source : AC3 44) chain C residue 27 type ligand sequence T description binding site for residue 96D C 401 source : AC3 45) chain C residue 28 type ligand sequence G description binding site for residue 96D C 401 source : AC3 46) chain C residue 29 type ligand sequence E description binding site for residue 96D C 401 source : AC3 47) chain C residue 30 type ligand sequence L description binding site for residue 96D C 401 source : AC3 48) chain C residue 31 type ligand sequence T description binding site for residue 96D C 401 source : AC3 49) chain C residue 34 type ligand sequence L description binding site for residue 96D C 401 source : AC3 50) chain B residue 26 type ligand sequence G description binding site for residue 96D D 401 source : AC4 51) chain B residue 27 type ligand sequence T description binding site for residue 96D D 401 source : AC4 52) chain B residue 28 type ligand sequence G description binding site for residue 96D D 401 source : AC4 53) chain D residue 17 type ligand sequence V description binding site for residue 96D D 401 source : AC4 54) chain D residue 20 type ligand sequence E description binding site for residue 96D D 401 source : AC4 55) chain D residue 21 type ligand sequence G description binding site for residue 96D D 401 source : AC4 56) chain D residue 22 type ligand sequence R description binding site for residue 96D D 401 source : AC4 57) chain D residue 24 type ligand sequence A description binding site for residue 96D D 401 source : AC4 58) chain D residue 25 type ligand sequence R description binding site for residue 96D D 401 source : AC4 59) chain D residue 26 type ligand sequence G description binding site for residue 96D D 401 source : AC4 60) chain D residue 27 type ligand sequence T description binding site for residue 96D D 401 source : AC4 61) chain D residue 28 type ligand sequence G description binding site for residue 96D D 401 source : AC4 62) chain D residue 29 type ligand sequence E description binding site for residue 96D D 401 source : AC4 63) chain D residue 30 type ligand sequence L description binding site for residue 96D D 401 source : AC4 64) chain D residue 31 type ligand sequence T description binding site for residue 96D D 401 source : AC4 65) chain D residue 34 type ligand sequence L description binding site for residue 96D D 401 source : AC4 66) chain D residue 177 type ligand sequence M description binding site for residue 96D D 401 source : AC4 67) chain A residue 273-285 type prosite ligand sequence GKLRLLYECNPMA description Fructose-1-6-bisphosphatase active site.[AG]-[RK]-[LI]-x(1,2)-[LIV]-[FY]-E-x(2)-P-[LIVM]-[GSA]. source prosite : PS00124 68) chain B residue 273-285 type prosite ligand sequence GKLRLLYECNPMA description Fructose-1-6-bisphosphatase active site.[AG]-[RK]-[LI]-x(1,2)-[LIV]-[FY]-E-x(2)-P-[LIVM]-[GSA]. source prosite : PS00124 69) chain C residue 273-285 type prosite ligand sequence GKLRLLYECNPMA description Fructose-1-6-bisphosphatase active site.[AG]-[RK]-[LI]-x(1,2)-[LIV]-[FY]-E-x(2)-P-[LIVM]-[GSA]. source prosite : PS00124 70) chain D residue 273-285 type prosite ligand sequence GKLRLLYECNPMA description Fructose-1-6-bisphosphatase active site.[AG]-[RK]-[LI]-x(1,2)-[LIV]-[FY]-E-x(2)-P-[LIVM]-[GSA]. source prosite : PS00124 71) chain A residue 17-18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence VM description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 72) chain A residue 20-22 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence EGR description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 73) chain A residue 24-31 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence ARGTGELT description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 74) chain A residue 34 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence L description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 75) chain A residue 113 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence Y description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 76) chain A residue 177 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 77) chain C residue 18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 78) chain C residue 26-28 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence GTG description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_A_401 79) chain A residue 18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 80) chain A residue 26-28 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence GTG description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 81) chain C residue 16-18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence FVM description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 82) chain C residue 20-22 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence EGR description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 83) chain C residue 24-31 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence ARGTGELT description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 84) chain C residue 34 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence L description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 85) chain C residue 113 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence Y description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 86) chain C residue 177 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_C_401 87) chain B residue 17-18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence VM description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 88) chain B residue 20-22 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence EGR description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 89) chain B residue 24-31 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence ARGTGELT description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 90) chain B residue 34 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence L description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 91) chain B residue 113 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence Y description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 92) chain B residue 177 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 93) chain D residue 18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 94) chain D residue 26-28 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence GTG description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_B_401 95) chain B residue 18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 96) chain B residue 26-28 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence GTG description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 97) chain D residue 16-18 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence FVM description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 98) chain D residue 20-22 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence EGR description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 99) chain D residue 24-31 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence ARGTGELT description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 100) chain D residue 34 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence L description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 101) chain D residue 113 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence Y description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401 102) chain D residue 177 type binding ligand 96D: N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide sequence M description N-[(5-cyanopyrazin-2-yl)carbamoyl]-3-(difluoromethoxy)benzene-1-sulfonamide binding site source pdb_hetatom : 96D_5q0a_D_401

Display surface Download Links