eF-site ID 5q08-ABCDEFGH
PDB Code 5q08
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(1-benzothiophen-3-ylsulfonyl)-3-(5-bromo-1,3-thiazol-2-yl)urea
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Fructose-1,6-bisphosphatase 1
Source (Q2TU34_HUMAN)
Sequence A:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
C:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
D:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
E:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVS
EEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIF
GIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLA
MDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYA
KDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMAT
TGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
F:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
G:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
H:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV
RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE
DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI
YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD
CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD
FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY
GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG
KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Description (1)  Fructose-1,6-bisphosphatase 1


Functional site

1) chain A
residue 17
type
ligand
sequence V
description binding site for residue 967 A 401
source : AC1

2) chain A
residue 18
type
ligand
sequence M
description binding site for residue 967 A 401
source : AC1

3) chain A
residue 21
type
ligand
sequence G
description binding site for residue 967 A 401
source : AC1

4) chain A
residue 22
type
ligand
sequence R
description binding site for residue 967 A 401
source : AC1

5) chain A
residue 24
type
ligand
sequence A
description binding site for residue 967 A 401
source : AC1

6) chain A
residue 26
type
ligand
sequence G
description binding site for residue 967 A 401
source : AC1

7) chain A
residue 27
type
ligand
sequence T
description binding site for residue 967 A 401
source : AC1

8) chain A
residue 28
type
ligand
sequence G
description binding site for residue 967 A 401
source : AC1

9) chain A
residue 29
type
ligand
sequence E
description binding site for residue 967 A 401
source : AC1

10) chain A
residue 30
type
ligand
sequence L
description binding site for residue 967 A 401
source : AC1

11) chain A
residue 31
type
ligand
sequence T
description binding site for residue 967 A 401
source : AC1

12) chain C
residue 27
type
ligand
sequence T
description binding site for residue 967 A 401
source : AC1

13) chain B
residue 17
type
ligand
sequence V
description binding site for residue 967 B 401
source : AC2

14) chain B
residue 21
type
ligand
sequence G
description binding site for residue 967 B 401
source : AC2

15) chain B
residue 22
type
ligand
sequence R
description binding site for residue 967 B 401
source : AC2

16) chain B
residue 24
type
ligand
sequence A
description binding site for residue 967 B 401
source : AC2

17) chain B
residue 26
type
ligand
sequence G
description binding site for residue 967 B 401
source : AC2

18) chain B
residue 27
type
ligand
sequence T
description binding site for residue 967 B 401
source : AC2

19) chain B
residue 28
type
ligand
sequence G
description binding site for residue 967 B 401
source : AC2

20) chain B
residue 29
type
ligand
sequence E
description binding site for residue 967 B 401
source : AC2

21) chain B
residue 30
type
ligand
sequence L
description binding site for residue 967 B 401
source : AC2

22) chain B
residue 31
type
ligand
sequence T
description binding site for residue 967 B 401
source : AC2

23) chain D
residue 27
type
ligand
sequence T
description binding site for residue 967 B 401
source : AC2

24) chain D
residue 28
type
ligand
sequence G
description binding site for residue 967 B 401
source : AC2

25) chain A
residue 27
type
ligand
sequence T
description binding site for residue 967 C 401
source : AC3

26) chain A
residue 28
type
ligand
sequence G
description binding site for residue 967 C 401
source : AC3

27) chain C
residue 17
type
ligand
sequence V
description binding site for residue 967 C 401
source : AC3

28) chain C
residue 18
type
ligand
sequence M
description binding site for residue 967 C 401
source : AC3

29) chain C
residue 21
type
ligand
sequence G
description binding site for residue 967 C 401
source : AC3

30) chain C
residue 22
type
ligand
sequence R
description binding site for residue 967 C 401
source : AC3

31) chain C
residue 24
type
ligand
sequence A
description binding site for residue 967 C 401
source : AC3

32) chain C
residue 26
type
ligand
sequence G
description binding site for residue 967 C 401
source : AC3

33) chain C
residue 27
type
ligand
sequence T
description binding site for residue 967 C 401
source : AC3

34) chain C
residue 28
type
ligand
sequence G
description binding site for residue 967 C 401
source : AC3

35) chain C
residue 29
type
ligand
sequence E
description binding site for residue 967 C 401
source : AC3

36) chain C
residue 30
type
ligand
sequence L
description binding site for residue 967 C 401
source : AC3

37) chain C
residue 31
type
ligand
sequence T
description binding site for residue 967 C 401
source : AC3

38) chain B
residue 27
type
ligand
sequence T
description binding site for residue 967 D 401
source : AC4

39) chain B
residue 28
type
ligand
sequence G
description binding site for residue 967 D 401
source : AC4

40) chain D
residue 17
type
ligand
sequence V
description binding site for residue 967 D 401
source : AC4

41) chain D
residue 21
type
ligand
sequence G
description binding site for residue 967 D 401
source : AC4

42) chain D
residue 22
type
ligand
sequence R
description binding site for residue 967 D 401
source : AC4

43) chain D
residue 24
type
ligand
sequence A
description binding site for residue 967 D 401
source : AC4

44) chain D
residue 26
type
ligand
sequence G
description binding site for residue 967 D 401
source : AC4

45) chain D
residue 27
type
ligand
sequence T
description binding site for residue 967 D 401
source : AC4

46) chain D
residue 28
type
ligand
sequence G
description binding site for residue 967 D 401
source : AC4

47) chain D
residue 29
type
ligand
sequence E
description binding site for residue 967 D 401
source : AC4

48) chain D
residue 30
type
ligand
sequence L
description binding site for residue 967 D 401
source : AC4

49) chain D
residue 31
type
ligand
sequence T
description binding site for residue 967 D 401
source : AC4

50) chain E
residue 17
type
ligand
sequence V
description binding site for residue 967 E 401
source : AC5

51) chain E
residue 21
type
ligand
sequence G
description binding site for residue 967 E 401
source : AC5

52) chain E
residue 22
type
ligand
sequence R
description binding site for residue 967 E 401
source : AC5

53) chain E
residue 24
type
ligand
sequence A
description binding site for residue 967 E 401
source : AC5

54) chain E
residue 26
type
ligand
sequence G
description binding site for residue 967 E 401
source : AC5

55) chain E
residue 27
type
ligand
sequence T
description binding site for residue 967 E 401
source : AC5

56) chain E
residue 28
type
ligand
sequence G
description binding site for residue 967 E 401
source : AC5

57) chain E
residue 29
type
ligand
sequence E
description binding site for residue 967 E 401
source : AC5

58) chain E
residue 30
type
ligand
sequence L
description binding site for residue 967 E 401
source : AC5

59) chain E
residue 31
type
ligand
sequence T
description binding site for residue 967 E 401
source : AC5

60) chain G
residue 27
type
ligand
sequence T
description binding site for residue 967 E 401
source : AC5

61) chain G
residue 28
type
ligand
sequence G
description binding site for residue 967 E 401
source : AC5

62) chain F
residue 17
type
ligand
sequence V
description binding site for residue 967 F 401
source : AC6

63) chain F
residue 18
type
ligand
sequence M
description binding site for residue 967 F 401
source : AC6

64) chain F
residue 21
type
ligand
sequence G
description binding site for residue 967 F 401
source : AC6

65) chain F
residue 22
type
ligand
sequence R
description binding site for residue 967 F 401
source : AC6

66) chain F
residue 24
type
ligand
sequence A
description binding site for residue 967 F 401
source : AC6

67) chain F
residue 26
type
ligand
sequence G
description binding site for residue 967 F 401
source : AC6

68) chain F
residue 27
type
ligand
sequence T
description binding site for residue 967 F 401
source : AC6

69) chain F
residue 28
type
ligand
sequence G
description binding site for residue 967 F 401
source : AC6

70) chain F
residue 29
type
ligand
sequence E
description binding site for residue 967 F 401
source : AC6

71) chain F
residue 30
type
ligand
sequence L
description binding site for residue 967 F 401
source : AC6

72) chain F
residue 31
type
ligand
sequence T
description binding site for residue 967 F 401
source : AC6

73) chain H
residue 27
type
ligand
sequence T
description binding site for residue 967 F 401
source : AC6

74) chain H
residue 28
type
ligand
sequence G
description binding site for residue 967 F 401
source : AC6

75) chain E
residue 27
type
ligand
sequence T
description binding site for residue 967 G 401
source : AC7

76) chain E
residue 28
type
ligand
sequence G
description binding site for residue 967 G 401
source : AC7

77) chain G
residue 17
type
ligand
sequence V
description binding site for residue 967 G 401
source : AC7

78) chain G
residue 18
type
ligand
sequence M
description binding site for residue 967 G 401
source : AC7

79) chain G
residue 21
type
ligand
sequence G
description binding site for residue 967 G 401
source : AC7

80) chain G
residue 22
type
ligand
sequence R
description binding site for residue 967 G 401
source : AC7

81) chain G
residue 24
type
ligand
sequence A
description binding site for residue 967 G 401
source : AC7

82) chain G
residue 26
type
ligand
sequence G
description binding site for residue 967 G 401
source : AC7

83) chain G
residue 27
type
ligand
sequence T
description binding site for residue 967 G 401
source : AC7

84) chain G
residue 28
type
ligand
sequence G
description binding site for residue 967 G 401
source : AC7

85) chain G
residue 29
type
ligand
sequence E
description binding site for residue 967 G 401
source : AC7

86) chain G
residue 30
type
ligand
sequence L
description binding site for residue 967 G 401
source : AC7

87) chain G
residue 31
type
ligand
sequence T
description binding site for residue 967 G 401
source : AC7

88) chain F
residue 27
type
ligand
sequence T
description binding site for residue 967 H 401
source : AC8

89) chain F
residue 28
type
ligand
sequence G
description binding site for residue 967 H 401
source : AC8

90) chain H
residue 17
type
ligand
sequence V
description binding site for residue 967 H 401
source : AC8

91) chain H
residue 21
type
ligand
sequence G
description binding site for residue 967 H 401
source : AC8

92) chain H
residue 22
type
ligand
sequence R
description binding site for residue 967 H 401
source : AC8

93) chain H
residue 24
type
ligand
sequence A
description binding site for residue 967 H 401
source : AC8

94) chain H
residue 26
type
ligand
sequence G
description binding site for residue 967 H 401
source : AC8

95) chain H
residue 27
type
ligand
sequence T
description binding site for residue 967 H 401
source : AC8

96) chain H
residue 28
type
ligand
sequence G
description binding site for residue 967 H 401
source : AC8

97) chain H
residue 29
type
ligand
sequence E
description binding site for residue 967 H 401
source : AC8

98) chain H
residue 30
type
ligand
sequence L
description binding site for residue 967 H 401
source : AC8

99) chain H
residue 31
type
ligand
sequence T
description binding site for residue 967 H 401
source : AC8

100) chain A
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

101) chain A
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

102) chain A
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

103) chain A
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

104) chain A
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

105) chain C
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

106) chain C
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_A_401

107) chain A
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

108) chain A
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

109) chain C
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

110) chain C
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

111) chain C
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

112) chain C
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

113) chain C
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_C_401

114) chain B
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

115) chain B
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

116) chain B
residue 24
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence A
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

117) chain B
residue 26-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence GTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

118) chain B
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

119) chain B
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

120) chain D
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

121) chain D
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_B_401

122) chain B
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

123) chain B
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

124) chain D
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

125) chain D
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

126) chain D
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

127) chain D
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

128) chain D
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_D_401

129) chain E
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

130) chain E
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

131) chain E
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

132) chain E
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

133) chain E
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

134) chain G
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

135) chain G
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_E_401

136) chain E
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

137) chain E
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

138) chain G
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

139) chain G
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

140) chain G
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

141) chain G
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

142) chain G
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_G_401

143) chain F
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

144) chain F
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

145) chain F
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

146) chain F
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

147) chain F
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

148) chain H
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

149) chain H
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_F_401

150) chain F
residue 27-28
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TG
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

151) chain F
residue 31-32
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence TQ
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

152) chain H
residue 17-18
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence VM
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

153) chain H
residue 20-22
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence EGR
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

154) chain H
residue 24-31
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence ARGTGELT
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

155) chain H
residue 113
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence Y
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401

156) chain H
residue 177
type binding
ligand 967: N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide
sequence M
description N-[(5-bromo-1,3-thiazol-2-yl)carbamoyl]-1-benzothiophene-3-sulfonamide binding site
source pdb_hetatom : 967_5q08_H_401


Display surface

Download
Links