eF-site ID 5q07-B PDB Code 5q07 Chain B click to enlarge Title Human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, E.C.3.1.3.11) complexed with the allosteric inhibitor 1-(4-bromo-6-morpholin-4-ylpyridin-2-yl)-3-[5-(2-methoxyethyl)-4-methylthiophen-2-yl]sulfonylurea Classification HYDROLASE/HYDROLASE inhibitor Compound Fructose-1,6-bisphosphatase 1 Source (Q2TU34_HUMAN) Sequence B:  DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAV RKAGIAHLYGIAGKLDVLSNDLVMNMLKSSFATCVLVSEE DKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGI YRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMD CGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKD FDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVY GGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTG KEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS Description (1)  Fructose-1,6-bisphosphatase 1 Functional site 1) chain B residue 17 type ligand sequence V description binding site for residue 95Y B 401 source : AC2 2) chain B residue 20 type ligand sequence E description binding site for residue 95Y B 401 source : AC2 3) chain B residue 21 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 4) chain B residue 22 type ligand sequence R description binding site for residue 95Y B 401 source : AC2 5) chain B residue 24 type ligand sequence A description binding site for residue 95Y B 401 source : AC2 6) chain B residue 25 type ligand sequence R description binding site for residue 95Y B 401 source : AC2 7) chain B residue 26 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 8) chain B residue 27 type ligand sequence T description binding site for residue 95Y B 401 source : AC2 9) chain B residue 28 type ligand sequence G description binding site for residue 95Y B 401 source : AC2 10) chain B residue 29 type ligand sequence E description binding site for residue 95Y B 401 source : AC2 11) chain B residue 30 type ligand sequence L description binding site for residue 95Y B 401 source : AC2 12) chain B residue 31 type ligand sequence T description binding site for residue 95Y B 401 source : AC2 13) chain B residue 160 type ligand sequence V description binding site for residue 95Y B 401 source : AC2 14) chain B residue 26 type ligand sequence G description binding site for residue 95Y D 401 source : AC4 15) chain B residue 27 type ligand sequence T description binding site for residue 95Y D 401 source : AC4 16) chain B residue 273-285 type prosite ligand sequence GKLRLLYECNPMA description Fructose-1-6-bisphosphatase active site.[AG]-[RK]-[LI]-x(1,2)-[LIV]-[FY]-E-x(2)-P-[LIVM]-[GSA]. source prosite : PS00124 17) chain B residue 17-18 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence VM description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 18) chain B residue 20-22 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence EGR description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 19) chain B residue 24-31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence ARGTGELT description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 20) chain B residue 34 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence L description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 21) chain B residue 113 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence Y description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 22) chain B residue 160 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence V description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 23) chain B residue 177-178 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence MD description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_B_401 24) chain B residue 26-28 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence GTG description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401 25) chain B residue 31 type binding ligand 95Y: N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide sequence T description N-{[4-bromo-6-(morpholin-4-yl)pyridin-2-yl]carbamoyl}-5-(2-methoxyethyl)-4-methylthiophene-2-sulfonamide binding site source pdb_hetatom : 95Y_5q07_D_401

Display surface Download Links